Tested Applications
| Positive WB detected in | mouse heart tissue, SMMC-7721 cells, mouse kidney tissue, A549 cells, HepG2 cells |
| Positive IHC detected in | human lung cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:100-1:400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IHC | See 3 publications below |
Product Information
26824-1-AP targets CPA4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25327 Product name: Recombinant human CPA4 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 316-384 aa of BC052289 Sequence: YPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELR Predict reactive species |
| Full Name | carboxypeptidase A4 |
| Calculated Molecular Weight | 421 aa, 47 kDa |
| Observed Molecular Weight | 44 kDa, 150 kDa |
| GenBank Accession Number | BC052289 |
| Gene Symbol | CPA4 |
| Gene ID (NCBI) | 51200 |
| RRID | AB_2880648 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UI42 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Carboxypeptidase A4 (CPA4), a member of the metallocarboxypeptidase family, is a zinc-containing exopeptidase that catalyzes the release of carboxy-terminal amino acids. CPA4 was previously shown to play a crucial role in cell growth and differentiation by modulating or inactivating peptide hormone activity (PMID: 27904708). CPA4 expression is increased in multiple cancer tissues, including tissues from patients with pancreatic cancer, gastric cancer, esophageal squamous cell carcinoma, and lung cancer, and may serve as a potential diagnostic and prognostic marker (PMID: 31397502, 32922037).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CPA4 antibody 26824-1-AP | Download protocol |
| WB protocol for CPA4 antibody 26824-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Death Dis Carboxypeptidase A4 negatively regulates HGS-ETR1/2-induced pyroptosis by forming a positive feedback loop with the AKT signalling pathway | ||
Sci Signal Hypoxic cancer-associated fibroblasts increase NCBP2-AS2/HIAR to promote endothelial sprouting through enhanced VEGF signaling. | ||
Eur J Med Res CPA4 overexpression correlates with poor prognosis and tumor progression in endometrial cancer | ||
Acta Biochim Biophys Sin (Shanghai) Angiopoietin-1 promotes triple-negative breast cancer cell proliferation by upregulating carboxypeptidase A4 | ||
J Cell Mol Med CPA4 as a biomarker promotes the proliferation, migration and metastasis of clear cell renal cell carcinoma cells |













