Tested Applications
| Positive WB detected in | HeLa cells, HepG2 cells, Jurkat cells, PC-3 cells, MDA-MB-231 cells, SW480 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human liver tissue, human heart tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | SW480 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 14 publications below |
| IF | See 1 publications below |
Product Information
15489-1-AP targets CPSF6 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7852 Product name: Recombinant human CPSF6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000714 Sequence: MADGVDHIDIYADVGEEFNQEAEYGGHDQIDLYDDVISPSANNGDAPEDRDYMDTLPPTVGDDVGKGAAPNVVYTYTGKRIALYIGNLTWWTTDEDLTEAVHSLGVNDILEIKFFENRANGQSKGFALVGVGSEASSKKLMDLLPKRELHGQNPVVTPCNKQFLSQFEMQSRKTTQSGQMSGEGKAGPPGGSSRAAFPQGGRGRGRFPGAVPGGDRFPGPAGPGGPPPPFPGNLIKHLVKGTRPLFLETRIPWHMGHSIEEIPIFGLKAGQTPPRPPLGPPGPPGPPGPPPPGQVLPPPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPPPPQQ Predict reactive species |
| Full Name | cleavage and polyadenylation specific factor 6, 68kDa |
| Calculated Molecular Weight | 59 kDa |
| Observed Molecular Weight | 55-68 kDa |
| GenBank Accession Number | BC000714 |
| Gene Symbol | CPSF6 |
| Gene ID (NCBI) | 11052 |
| RRID | AB_10694140 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q16630 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The binding of Cleavage factor Im (CFIM), also known as CPSF6, to the pre-mRNA is one of the earliest steps in the assembly of the cleavage and polyadenylation machinery and facilitates the recruitment of other processing factors. CFIM is required for the first step in pre-mRNA 3′-end processing and can be reconstituted in vitro from its heterologously expressed 25- and 68-kDa subunits. It involved in RNA binding, protein-protein interactions, and subcellular localization [PMID:15169763]. In addition, it is a pre-mRNA processing protein that dynamically shuttles between the nucleus and the cytoplasm and contains a C-terminal nuclear-targeting arginine/serine-rich (RS-) domain of the type bound by TNPO3[PMID:15169763,19864460].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CPSF6 antibody 15489-1-AP | Download protocol |
| IHC protocol for CPSF6 antibody 15489-1-AP | Download protocol |
| IP protocol for CPSF6 antibody 15489-1-AP | Download protocol |
| WB protocol for CPSF6 antibody 15489-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
PLoS Pathog In Vivo Functions of CPSF6 for HIV-1 as Revealed by HIV-1 Capsid Evolution in HLA-B27-Positive Subjects. | ||
Elife Nuclear pore heterogeneity influences HIV-1 infection and the antiviral activity of MX2. | ||
Commun Biol IGF2BP3 recruits NUDT21 to regulate SPTBN1 alternative polyadenylation and drive ovarian cancer progression | ||
J Virol Cell type-dependent escape of capsid inhibitors by simian immunodeficiency virus SIVcpz. | ||
iScience Multi-omics approach reveals posttranscriptionally regulated genes are essential for human pluripotent stem cells. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tatyana (Verified Customer) (03-11-2023) | The signal is not very bright but specific (siRNA knockdown verified). Predominantly nuclear, as expected. 4% PFA fixation followed by methanol permeabilization; antibody prepared in 5% goat serum in PBST; overnight incubation (no blocking step).
|

































