Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CPT1B-specific Polyclonal antibody

CPT1B-specific Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 22170-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF-P, IP, ELISA

CPT1B, Carnitine O palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase 1, muscle isoform, Carnitine O-palmitoyltransferase I, muscle isoform, Carnitine palmitoyltransferase I-like protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse skeletal muscle tissue, mouse heart tissue, rat heart tissue, rat skeletal muscle tissue
Positive IP detected inmouse heart tissue, mouse skeletal muscle tissue
Positive IHC detected inmouse heart tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse heart tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:10000-1:80000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22170-1-AP targets CPT1B-specific in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, zebrafish, sheep, ewes
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17840

Product name: Recombinant human CPT1B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 110-250 aa of BC131570

Sequence: FNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDLEMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVALDEESYSYDPEDEASLSLYGKALLHGNCYNRWF

Predict reactive species
Full Name carnitine palmitoyltransferase 1B (muscle)
Calculated Molecular Weight 567 aa, 64 kDa
Observed Molecular Weight 75-85 kDa
GenBank Accession NumberBC131570
Gene Symbol CPT1B
Gene ID (NCBI) 1375
RRIDAB_2713959
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92523
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carnitine palmitoyltransferases (CPTs) mediate the transport of long chain fatty acyl groups into the mitochondrial matrix to undergo b-oxidation. Type I CPT resides in the outer mitochondrial membrane. Mammalian tissues express three isoforms: CPT1A (liver), CPT1B (muscle and heart), and CPT1C (brain). Several isoforms of CPT1B exist due to the alternative splicing, with predicted MW of 88/84/79/66 kDa.

Protocols

Product Specific Protocols
IF protocol for CPT1B-specific antibody 22170-1-APDownload protocol
IHC protocol for CPT1B-specific antibody 22170-1-APDownload protocol
IP protocol for CPT1B-specific antibody 22170-1-APDownload protocol
WB protocol for CPT1B-specific antibody 22170-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
ratWB

Cell Metab

A mechanosensitive lipolytic factor in the bone marrow promotes osteogenesis and lymphopoiesis.

Authors - Hui Peng
mouseWB

Cell Metab

Global Analysis of Plasma Lipids Identifies Liver-Derived Acylcarnitines as a Fuel Source for Brown Fat Thermogenesis.

Authors - Judith Simcox
  • KD Validated
mouseWB

Nat Commun

Moderate-intensity interval exercise exacerbates cardiac lipotoxicity in high-fat, high-calories diet-fed mice

Authors - Jing Geng
humanWB

Adv Sci (Weinh)

m6A-Modified circTET2 Interacting with HNRNPC Regulates Fatty Acid Oxidation to Promote the Proliferation of Chronic Lymphocytic Leukemia

Authors - Zijuan Wu
mouseWB

Nat Commun

Mechanism of action and therapeutic route for a muscular dystrophy caused by a genetic defect in lipid metabolism.

Authors - Mahtab Tavasoli
humanWB

J Biomed Sci

Adipocyte pyroptosis occurs in omental tumor microenvironment and is associated with chemoresistance of ovarian cancer

Authors - Chang-Ni Lin

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Xhuljana (Verified Customer) (03-01-2024)

Tried in WB in C2C12 lysate, 30 *g

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: C2C12 cells
CPT1B-specific Antibody Western Blot validation (1:1000 dilution) in C2C12 cells (Cat no:22170-1-AP)

James (Verified Customer) (04-01-2021)

Green channel is CPT1B.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: lung
CPT1B-specific Antibody Immunofluorescence validation (1:100 dilution) in lung (Cat no:22170-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...