Filter: AllWBIPIHCIF-PFC (Intra)

WB analysis of Raji using 14348-1-AP
Raji cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of MCF-7 using 14348-1-AP
MCF7 cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 14348-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of human testis using 14348-1-AP
human testis tissue were subjected to SDS PAGE followed by western blot with 14348-1-AP (CRCP antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
IP experiment of Raji using 14348-1-AP
IP result of anti-CRCP (IP:14348-1-AP, 3ug; Detection:14348-1-AP 1:1000) with Raji cells lysate 2800ug.
IHC staining of human testis using 14348-1-AP
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14348-1-AP (CRCP Antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human testis using 14348-1-AP
Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14348-1-AP (CRCP Antibody) at dilution of 1:50 (under 40x lens).
IF Staining of mouse testis using 14348-1-AP
Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse testis tissue using CRCP antibody (14348-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
FC experiment of Raji using 14348-1-AP
1x10^6 Raji cells were intracellularly stained with 0.25 ug CRCP Polyclonal antibody (14348-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

CRCP Polyclonal antibody

CRCP Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), IP, ELISA

Cat No. 14348-1-AP

Publications(7)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, FC (Intra), IP, ELISA

Synonyms

Calcitonin gene-related peptide-receptor component protein, CGRP RCP, CGRP receptor component, CGRPRCP, CGRP-RCP

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488 CoraLite® Plus 647 CoraLite®555

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (7)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Raji cells, HeLa cells, human testis tissue, MCF-7 cells
Positive IP detected in	Raji cells
Positive IHC detected in	human testis tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF-P detected in	mouse testis tissue
Positive FC (Intra) detected in	Raji cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:4000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)-P	IF-P : 1:200-1:800
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 3 publications below
IF	See 5 publications below

Product Information

14348-1-AP targets CRCP in WB, IHC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag5689 Product name: Recombinant human CRCP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-115 aa of BC040107 Sequence: MEVKDANSALLSNYETLKYISKTPCRHQSPEIVREFLTALKSHKLTKAEKLQLLNHRPVTAVEIQLMVEESEERLTEEQIEALLHTVTSILPAEPEAEQKKNTNSNVAMDEEDPA Predict reactive species
Full Name	CGRP receptor component
Calculated Molecular Weight	17 kDa
Observed Molecular Weight	20 kDa
GenBank Accession Number	BC040107
Gene Symbol	CRCP
Gene ID (NCBI)	27297
RRID	AB_10641051
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O75575
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for CRCP antibody 14348-1-AP	Download protocol
IHC protocol for CRCP antibody 14348-1-AP	Download protocol
IP protocol for CRCP antibody 14348-1-AP	Download protocol
WB protocol for CRCP antibody 14348-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
rat,mouse	IF	J Neuroinflammation Calcitonin gene-related peptide regulates spinal microglial activation through the histone H3 lysine 27 trimethylation via enhancer of zeste homolog-2 in rats with neuropathic pain. Authors - Qi An View Article
human	WB	mSphere Genome-scale CRISPR/Cas9 screening reveals the role of PSMD4 in colibactin-mediated cell cycle arrest Authors - Michael W Dougherty View Article
human	WB	J Transl Med CircESRP1 enhances metastasis and epithelial-mesenchymal transition in endometrial cancer via the miR-874-3p/CPEB4 axis. Authors - Rui Shi View Article
rat	WB,IF	CNS Neurosci Ther Calcitonin gene-related peptide induces the histone H3 lysine 9 acetylation in astrocytes associated with neuroinflammation in rats with neuropathic pain. Authors - Chenyan Sun View Article
mouse	IF	Neurogastroenterol Motil Altered gene expression signatures by calcitonin gene-related peptide promoted mast cell activity in the colon of stress-induced visceral hyperalgesia mice. Authors - Hanliang Sun View Article
rat	IF	Cell Biochem Funct CNTs-CaP/chitosan-coated AZ91D magnesium alloy extract promoted rat dorsal root ganglia neuron growth via activating ERK signalling pathway. Authors - Tingjiao Liu View Article