• Featured Product
  • KD/KO Validated

TORC1/CRTC1 Polyclonal antibody

TORC1/CRTC1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 10441-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, IP, ELISA

CRTC1, CREB-regulated transcription coactivator 1, KIAA0616, MECT1, TORC 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse kidney tissue, A431 cells, Jurkat cells, L02 cells, mouse brain tissue
Positive IP detected inmouse kidney tissue
Positive IHC detected inhuman colon cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10441-1-AP targets TORC1/CRTC1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0693

Product name: Recombinant human TORC1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-300 aa of BC028050

Sequence: MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTP

Predict reactive species
Full Name CREB regulated transcription coactivator 1
Calculated Molecular Weight 75 kDa
Observed Molecular Weight 68-80 kDa
GenBank Accession NumberBC028050
Gene Symbol CRTC1
Gene ID (NCBI) 23373
RRIDAB_2083835
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6UUV9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CRTC1, also named as MECT1,TORC1, and WAMTP1, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. CRTC1 acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. It enhances the interaction of CREB1 with TAF4. CRTC1 regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. It is a potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. CRTC1 is also a coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR). In the hippocampus, CRTC1 involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. It may be required for dendritic growth of developing cortical neurons. This is a rabbit polyclonal antibody raised against residues near N terminus of human CRTC1. CRTC1 has some isoforms produced by alternative splicing with MW of 67 kDa, 68 kDa and 62 kDa. Sometimes it appears as a 75-80 kDa band probably due to phosphorylation (PMID: 17183642; 22770221)

Protocols

Product Specific Protocols
WB protocol for TORC1/CRTC1 antibody 10441-1-APDownload protocol
IHC protocol for TORC1/CRTC1 antibody 10441-1-APDownload protocol
IP protocol for TORC1/CRTC1 antibody 10441-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Eosinophil extracellular traps drive asthma progression through neuro-immune signals.

Authors - Yiwen Lu
  • KD Validated
mouseWB,IP

iScience

Neural and central mechanisms of kidney fibrosis after relief of ureteral obstruction

Authors - Huanjuan Su
IHC

J Ethnopharmacol

Exploring the potential mechanism of Heng-Gu-Gu-Shang-Yu-He-Ji therapy for osteoporosis based on network pharmacology and transcriptomics

Authors - Linbi Xie
mouseWB

Sci Rep

Targeted Metabolomics Reveals Abnormal Hepatic Energy Metabolism by Depletion of β-Carotene Oxygenase 2 in Mice.

Authors - Lei Wu

Ann N Y Acad Sci

PMID: 26645136

Authors - Holly M Brown-Borg
ratWB,IF

J Agric Food Chem

Fluoride Stimulates Anxiety- and Depression-like Behaviors Associated with SIK2-CRTC1 Signaling Dysfunction.

Authors - Guoyu Zhou
Loading...
||
New chat Able
正在加载,请稍候...