Tested Applications
Positive WB detected in | A431 cells, K-562 cells, HEK-293 cells |
Positive IP detected in | A431 cells |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 1 publications below |
WB | See 2 publications below |
IF | See 2 publications below |
IP | See 1 publications below |
Product Information
24290-1-AP targets CSTF3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17930 Product name: Recombinant human CSTF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC059948 Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN Predict reactive species |
Full Name | cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa |
Calculated Molecular Weight | 717 aa, 83 kDa |
Observed Molecular Weight | 77-83 kDa |
GenBank Accession Number | BC059948 |
Gene Symbol | CSTF3 |
Gene ID (NCBI) | 1479 |
RRID | AB_2879475 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q12996 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CSTF3 antibody 24290-1-AP | Download protocol |
IHC protocol for CSTF3 antibody 24290-1-AP | Download protocol |
IP protocol for CSTF3 antibody 24290-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
iScience Chromodomain helicase DNA-binding domain 2 maintains spermatogonial self-renewal by promoting chromatin accessibility and mRNA stability
| ||
Comput Struct Biotechnol J Alternative polyadenylation regulates the translation of metabolic and inflammation-related proteins in adipose tissue of gestational diabetes mellitus | ||
Cell Death Dis CSTF3 contributes to platinum resistance in ovarian cancer through alternative polyadenylation of lncRNA NEAT1 and generating the short isoform NEAT1_1 |