Tested Applications
| Positive WB detected in | A431 cells, K-562 cells, HEK-293 cells |
| Positive IP detected in | A431 cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 2 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
24290-1-AP targets CSTF3 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17930 Product name: Recombinant human CSTF3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC059948 Sequence: MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAWSILIREAQNQPIDKARKTYERLVAQFPSSGRFWKLYIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN Predict reactive species |
| Full Name | cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa |
| Calculated Molecular Weight | 717 aa, 83 kDa |
| Observed Molecular Weight | 77-83 kDa |
| GenBank Accession Number | BC059948 |
| Gene Symbol | CSTF3 |
| Gene ID (NCBI) | 1479 |
| RRID | AB_2879475 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q12996 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CSTF3 antibody 24290-1-AP | Download protocol |
| IP protocol for CSTF3 antibody 24290-1-AP | Download protocol |
| WB protocol for CSTF3 antibody 24290-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Comput Struct Biotechnol J Alternative polyadenylation regulates the translation of metabolic and inflammation-related proteins in adipose tissue of gestational diabetes mellitus | ||
Cell Death Dis CSTF3 contributes to platinum resistance in ovarian cancer through alternative polyadenylation of lncRNA NEAT1 and generating the short isoform NEAT1_1 | ||
iScience Chromodomain helicase DNA-binding domain 2 maintains spermatogonial self-renewal by promoting chromatin accessibility and mRNA stability
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Sarah (Verified Customer) (10-31-2025) | Antibody works but with low signal for tested cell lines, though further optimization was not tried.
|











