Tested Applications
Positive WB detected in | HeLa cells, HepG2 cells, MCF-7 cells, SMMC-7721 cells, mouse colon tissue |
Positive IHC detected in | human prostate cancer tissue, human liver cancer tissue, human liver tissue, human kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
12599-1-AP targets CTBS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3228 Product name: Recombinant human CTBS protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC024007 Sequence: MSRPQLRRWRLVSSPPSGVPGLALLALLALRLAAGTDCPCPEPELCRPIRHHPDFEVFVFDVGQKTWKSYDWSQITTVATFGKYDSELMCYAHSKGARVVLKGNL Predict reactive species |
Full Name | chitobiase, di-N-acetyl- |
Calculated Molecular Weight | 12 kDa, 43 kDa |
Observed Molecular Weight | 44-50 kDa |
GenBank Accession Number | BC024007 |
Gene Symbol | CTBS |
Gene ID (NCBI) | 1486 |
RRID | AB_10638783 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q01459 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CTBS(Di-N-acetylchitobiase (chitobiase)) also named as CTB, is a lysosomal exoglycosidase that splits the GlcNAcβ-D-(l-4)GlcNAc chitobiose core of asparagine-linked glycoproteins. Chitobiase has been purified from human liver and kidney and rat liver. Both the human and rat enzymes are approximately 40-45 kDa and require a free reducing end GlcNAc for activity(PMID:1527079). This full length protein has a signal peptide and four glycosylation sites.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for CTBS antibody 12599-1-AP | Download protocol |
IHC protocol for CTBS antibody 12599-1-AP | Download protocol |
IF protocol for CTBS antibody 12599-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |