Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

p120 Catenin Polyclonal antibody

p120 Catenin Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 12180-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

CTNND1, Cadherin-associated Src substrate, CAS, Catenin delta 1, Catenin delta-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12180-1-AP targets p120 Catenin in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2824

Product name: Recombinant human CTNND1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 546-830 aa of BC010501

Sequence: GYELLFQPEVVRIYISLLKESKTPAILEASAGAIQNLCAGRWTYGRYIRSALRQEKALSAIADLLTNEHERVVKAASGALRNLAVDARNKELIGKHAIPNLVKNLPGGQQNSSWNFSEDTVISILNTINEVIAENLEAAKKLRETQGIEKLVLINKSGNRSEKEVRAAALVLQTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPLKGTTPLMQKI

Predict reactive species
Full Name catenin (cadherin-associated protein), delta 1
Calculated Molecular Weight 948 aa, 105 kDa
Observed Molecular Weight 90-120 kDa
GenBank Accession NumberBC010501
Gene Symbol p120 Catenin
Gene ID (NCBI) 1500
RRIDAB_2086267
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO60716
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Catenins were discovered as proteins that are linked to the cytoplasmic domain of transmembrane cadherins (PMID: 9653641). p120 catenin, also called p120 ctn or catenin delta-1, regulates cell-cell adhesion through its interaction with the cytoplasmic tail of classical and type II cadherins. p120 catenin is a tyrosine kinase substrate implicated in cell transformation by SRC, as well as in ligand-induced receptor signaling through the EGF receptor, the PDGF receptor, and the CSF1 receptor. Different expression patterns of p120 catenin in lobular and ductal carcinomas of the breast have been reported: membrane stain for ductal carcinoma and cytoplasmic stain for lobular carcinoma (PMID: 24966968). Different isoforms of p120 catenin are variably expressed in different tissues as a result of alternative splicing and the use of multiple translation initiation codons (PMID: 19150613).

Protocols

Product Specific Protocols
IF protocol for p120 Catenin antibody 12180-1-APDownload protocol
IHC protocol for p120 Catenin antibody 12180-1-APDownload protocol
IP protocol for p120 Catenin antibody 12180-1-APDownload protocol
WB protocol for p120 Catenin antibody 12180-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseWB

Nat Hum Behav

Genome-wide meta-analysis, functional genomics and integrative analyses implicate new risk genes and therapeutic targets for anxiety disorders

Authors - Wenqiang Li
mouseWB

EMBO Mol Med

Inhibition of Sema4D/PlexinB1 signaling alleviates vascular dysfunction in diabetic retinopathy.

Authors - Jie-Hong Wu
WB

Ecotoxicol Environ Saf

A phosphoproteomic study uncovers the importance of PP2A-B56α in liver injury precipitated by NLRP3 activation during MC-LR exposure

Authors - Haimeng Yin
mouseWB

EBioMedicine

NDRG2 regulates adherens junction integrity to restrict colitis and tumourigenesis.

Authors - Mengying Wei
mouseWB

CNS Neurosci Ther

The Neuroprotective Mechanisms of PPAR-γ: Inhibition of Microglia-Mediated Neuroinflammation and Oxidative Stress in a Neonatal Mouse Model of Hypoxic-Ischemic White Matter Injury

Authors - Mingchu Fang
humanWB

Cell Cycle

Hsa-miR-425-5p promotes tumor growth and metastasis by activating the CTNND1-mediated β-catenin pathway and EMT in colorectal cancer.

Authors - Dingsheng Liu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Harikrishnan (Verified Customer) (12-04-2025)

The antibody works well for Immunoprecipitation

  • Applications: Western Blot, Immunoprecipitation
  • Cell Tissue Type: Mouse primary cardiac fibroblasts
Loading...
||
New chat

Able

正在加载,请稍候...