Tested Applications
| Positive WB detected in | LPS and Protein transport inhibitor treated HUVEC cells |
| Positive IHC detected in | human gliomas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 3 publications below |
| WB | See 29 publications below |
| IHC | See 42 publications below |
| IF | See 25 publications below |
| ELISA | See 3 publications below |
Product Information
12335-1-AP targets CXCL1 in WB, IHC, IF, ELISA, Cell treatment applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2917 Product name: Recombinant human CXCL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-107 aa of BC011976 Sequence: MARAALSAAPSNPRLLRVALLLLLLVAAGRRAAGASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN Predict reactive species |
| Full Name | chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha) |
| Calculated Molecular Weight | 8 kDa to 14 kDa |
| Observed Molecular Weight | 12 kDa |
| GenBank Accession Number | BC011976 |
| Gene Symbol | CXCL1 |
| Gene ID (NCBI) | 2919 |
| RRID | AB_2087568 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P09341 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CXCL1 a is a member of CXC family and also known as keratinocyte-derived chemokines (KC) or growth-related oncogene (GRO). CXCL1 is expressed by macrophages, neutrophils and epithelial cells. CXCL1 binding specifically to the CXC chemokine receptor CXCR2, is involved in fibrogenesis and angiogenesis. This protein also plays a role in inflammation and as a chemoattractant for neutrophils. CXCL1 is upregulated in some types of human cancer, including colorectal, bladder, breast, prostate and skin cancers.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CXCL1 antibody 12335-1-AP | Download protocol |
| WB protocol for CXCL1 antibody 12335-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cell Host Microbe Induction of bone loss by pathobiont-mediated Nod1 signaling in the oral cavity. | ||
J Exp Med An adaptive signaling network in melanoma inflammatory niches confers tolerance to MAPK signaling inhibition. | ||
Cell Rep Collagen 1-mediated CXCL1 secretion in tumor cells activates fibroblasts to promote radioresistance of esophageal cancer
| ||
Cell Rep Oral microbiota affects the efficacy and prognosis of radiotherapy for colorectal cancer in mouse models | ||
Cell Mol Life Sci Macrophage Dectin-1 mediates Ang II renal injury through neutrophil migration and TGF-β1 secretion |





