CXCL17 Polyclonal antibody

CXCL17 Polyclonal Antibody for IHC, ELISA

Cat No. 18108-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF, ELISA

4-Cys CXCL17, 6-Cys CXCL17, C X C motif chemokine 17, C-X-C motif chemokine 17, Dcip1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman colon cancer tissue, human breast cancer tissue, human liver cancer tissue, human lung squamous cell carcinoma tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18108-1-AP targets CXCL17 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12516

Product name: Recombinant human CXCL17 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 23-119 aa of BC093946

Sequence: SLNPGVARGHRDRGQASRRWLQEGGQECECKDWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQCQLRSFALPL

Predict reactive species
Full Name chemokine (C-X-C motif) ligand 17
Calculated Molecular Weight 119 aa, 14 kDa
GenBank Accession NumberBC093946
Gene Symbol CXCL17
Gene ID (NCBI) 284340
RRIDAB_2878502
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ6UXB2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CXCL17, also known as C-X-C motif chemokine 17, is a relatively newly discovered member of the CXC chemokine family, which plays a multifaceted role in immune responses and other biological processes. CXCL17 has been implicated in several human pathologies, and its role in mediating immune responses is of particular interest. It is involved in the recruitment of immune cells, angiogenesis, and control of microorganisms at mucosal barriers . It is also known to be involved in tumor angiogenesis and has shown both proinflammatory and anti-inflammatory effects. CXCL17 is highly expressed in the gastric mucosa and other mucosal tissues. Its receptor was identified as GPR35 and named CXCR8, although the functional role of this interaction is not yet fully understood. CXCL17's expression is associated with both disease progression and protection in various diseases. It has been linked to pulmonary fibrosis, asthma, lung cancer, and hepatic cancer, where increased expression is associated with disease progression. Conversely, it may play a protective role in pancreatic cancer, autoimmune encephalomyelitis, and viral infections. Research has shown that CXCL17 promotes neutrophil trafficking and plays a role in the early proinflammatory response by facilitating the recruitment of neutrophils to the site of insult . It also exhibits chemoattractant abilities targeting monocytes and macrophages and can induce the production of proangiogenic factors such as vascular endothelial growth factor A from treated monocytes

Protocols

Product Specific Protocols
IHC protocol for CXCL17 antibody 18108-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Nat Commun

Dissecting esophageal squamous-cell carcinoma ecosystem by single-cell transcriptomic analysis.

Authors - Xiannian Zhang
humanWB,IHC,IF

J Dermatol Sci

CXCL17-mediated downregulation of type I collagen via MMP1 and miR-29 in skin fibroblasts possibly contributes to the fibrosis in systemic sclerosis.

Authors - Shuichi Shimada
humanIHC

Cancers (Basel)

A Novel Risk Score Model of Lactate Metabolism for Predicting over Survival and Immune Signature in Lung Adenocarcinoma

Authors - Zhou Jiang
humanWB,IHC

Curr Issues Mol Biol

Loss of CCL28 and CXCL17 Expression and Increase in CCR1 Expression May Be Related to Malignant Transformation of LGBLEL into Lymphoma

Authors - Rui Liu
humanWB

Metab Brain Dis

Sequencing and Bioinformatics analysis of lncRNA/circRNA-miRNA-mRNA in Glioblastoma multiforme

Authors - Renjie Wang
humanWB,IHC

Int J Med Sci

OCT4 promotes lung cancer progression through upregulation of VEGF-correlated chemokine-1

Authors - Bing-Hua Su
  • KD Validated
Loading...
||
New chat

Able

正在加载,请稍候...