Filter: AllWBIHC

WB analysis of human liver using 12365-1-AP
human liver tissue were subjected to SDS PAGE followed by western blot with 12365-1-AP (CYB5A antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
IHC staining of human liver cancer using 12365-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 12365-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 12365-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 12365-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 12365-1-AP (Cytochrome b5 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human pancreas cancer using 12365-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 12365-1-AP (CYB5A antibody) at dilution of 1:50 (under 10x lens).

Cytochrome b5 Polyclonal antibody

Name: Cytochrome b5 Polyclonal antibody
Brand: Proteintech
SKU: 12365-1-AP

Cytochrome b5 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12365-1-AP

Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CYB5, CYB5A, Cytochrome b5, MCB5

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (1)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	human liver tissue
Positive IHC detected in	human liver cancer tissue, human pancreas cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 1 publications below

Product Information

12365-1-AP targets Cytochrome b5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3038 Product name: Recombinant human Cytochrome b5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC015182 Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSS Predict reactive species
Full Name	cytochrome b5 type A (microsomal)
Calculated Molecular Weight	134 aa, 15 kDa
Observed Molecular Weight	15 kDa
GenBank Accession Number	BC015182
Gene Symbol	Cytochrome b5
Gene ID (NCBI)	1528
RRID	AB_2089808
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P00167
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for Cytochrome b5 antibody 12365-1-AP	Download protocol
WB protocol for Cytochrome b5 antibody 12365-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Proteomics Clin Appl Quantitative Proteome of Infant Stenotic Ureters Reveals Extracellular Matrix Organization and Oxidative Stress Dysregulation Underlying Ureteropelvic Junction Obstruction. Authors - Yueyan Li View Article

Products

Applications

cGMP Proteins

Support

Services

Promotions

About Us

Antibodies

Immunoassays

Cytokines and Growth Factors

Nanobody-based Reagents

Supporting Tools and Reagents

Research Area

Genomics

WB analysis of human liver using 12365-1-AP

IHC staining of human liver cancer using 12365-1-AP

IHC staining of human liver cancer using 12365-1-AP

IHC staining of human liver cancer using 12365-1-AP

IHC staining of human liver cancer using 12365-1-AP

IHC staining of human pancreas cancer using 12365-1-AP

Cytochrome b5 Polyclonal antibody

Cytochrome b5 Polyclonal Antibody for WB, IHC, ELISA

-/ -

Tested Applications

Recommended dilution

Published Applications

Product Information

Protocols

Publications

Quantitative Proteome of Infant Stenotic Ureters Reveals Extracellular Matrix Organization and Oxidative Stress Dysregulation Underlying Ureteropelvic Junction Obstruction.