Tested Applications
Positive WB detected in | human liver tissue |
Positive IHC detected in | human liver cancer tissue, human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
12365-1-AP targets Cytochrome b5 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3038 Product name: Recombinant human Cytochrome b5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC015182 Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSS Predict reactive species |
Full Name | cytochrome b5 type A (microsomal) |
Calculated Molecular Weight | 134 aa, 15 kDa |
Observed Molecular Weight | 15 kDa |
GenBank Accession Number | BC015182 |
Gene Symbol | Cytochrome b5 |
Gene ID (NCBI) | 1528 |
RRID | AB_2089808 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P00167 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Cytochrome b5 antibody 12365-1-AP | Download protocol |
IHC protocol for Cytochrome b5 antibody 12365-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |