Tested Applications
Positive WB detected in | mouse heart tissue, rat heart tissue |
Positive IHC detected in | human heart tissue, mouse heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse heart tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:12000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
IF | See 7 publications below |
Product Information
26592-1-AP targets Cardiac Troponin T in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24911 Product name: Recombinant human cTnT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC002653 Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVP Predict reactive species |
Full Name | troponin T type 2 (cardiac) |
Calculated Molecular Weight | 36 kDa |
Observed Molecular Weight | 34-40 kDa |
GenBank Accession Number | BC002653 |
Gene Symbol | Cardiac Troponin T |
Gene ID (NCBI) | 7139 |
RRID | AB_2880566 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P45379 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for Cardiac Troponin T antibody 26592-1-AP | Download protocol |
IHC protocol for Cardiac Troponin T antibody 26592-1-AP | Download protocol |
IF protocol for Cardiac Troponin T antibody 26592-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Biomaterials Targeted immunomodulation therapy for cardiac repair by platelet membrane engineering extracellular vesicles via hitching peripheral monocytes. | ||
Free Radic Biol Med SIRT3 promotes metabolic maturation of human iPSC-derived cardiomyocytes via OPA1-controlled mitochondrial dynamics | ||
Front Physiol The physiological response during optogenetic-based cardiac pacing in awake freely moving mice | ||
Clin Exp Hypertens Exploration and validation of signature genes and immune associations in septic cardiomyopathy | ||
Signal Transduct Target Ther Thiamine-modified metabolic reprogramming of human pluripotent stem cell-derived cardiomyocyte under space microgravity | ||
Nat Commun Fibroblast-specific PRMT5 deficiency suppresses cardiac fibrosis and left ventricular dysfunction in male mice |