Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Caspase 7 Polyclonal antibody

Caspase 7 Polyclonal Antibody for WB, IF/ICC, IF-P, IP, ELISA

Cat No. 27155-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (6)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA, Immunofluorescence, Western Blot

CASP7, Apoptotic protease Mch 3, Apoptotic protease Mch-3, CASP 7, CASP-7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HEK-293 cells, LNCaP cells, PC-3 cells, MCF-7 cells, mouse liver tissue
Positive IP detected inHEK-293 cells
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27155-1-AP targets Caspase 7 in WB, IHC, IF/ICC, IF-P, IP, ELISA, Immunofluorescence, Western Blot applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, bovine, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25904

Product name: Recombinant human Caspase 7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-100 aa of BC015799

Sequence: MADEQGCIEEQGVEDSANEDSVDAKPDRSSFVPSLFSKKKKNVTMRSIKTTRDRVPTYQYNMNFEKLGKCIIINNKNFDKVTGMGVRNGTDKDAEALFKC

Predict reactive species
Full Name caspase 7, apoptosis-related cysteine peptidase
Calculated Molecular Weight 303 aa, 34 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC015799
Gene Symbol Caspase 7
Gene ID (NCBI) 840
RRIDAB_2880779
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP55210
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Caspase 7(CASP7), like caspases 3 and 6, contains a short prodomain and, upon apoptotic induction, the 35 kDa proform is converted into a 32 kDa intermediate or preactive form which is further processed into two active subunits consisting of the p20 or large (18 kDa) subunit and the p10 or small (11 kDa) subunit and it is present in the brain, which is up-regulated and activated after traumatic injury(PMID:15953353). Caspase-7 is classified as a member of the subgroup of cysteine proteases most related to the Caenorhabditis elegans factor CED-3, which also includes caspase-3, -6, and -9(PMID:9426061). The protein is involved in the activation cascade of caspases responsible for apoptosis execution.

Protocols

Product Specific Protocols
IF protocol for Caspase 7 antibody 27155-1-APDownload protocol
IP protocol for Caspase 7 antibody 27155-1-APDownload protocol
WB protocol for Caspase 7 antibody 27155-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
ratWB

Nat Commun

Macrophage lineage cells-derived migrasomes activate complement-dependent blood-brain barrier damage in cerebral amyloid angiopathy mouse model

Authors - Mengyan Hu
humanWB

J Pineal Res

Melatonin synergizes the chemotherapeutic effect of 5-fluorouracil in colon cancer by suppressing PI3K/AKT and NF-κB/iNOS signaling pathways.

Authors - Yue Gao
humanWB

Cell Rep

Inhibiting G6PD by quercetin promotes degradation of EGFR T790M mutation

Authors - Zehe Ge
humanWB

Front Immunol

Identification of molecular subtypes based on PANoptosis-related genes and construction of a signature for predicting the prognosis and response to immunotherapy response in hepatocellular carcinoma

Authors - Jinfeng Zhu
humanWB

Phytother Res

Targeting HSP90 with picropodophyllin suppresses gastric cancer tumorigenesis by disrupting the association of HSP90 and AKT

Authors - Xiaoli Li
humanWB

Cell Death Discov

IDO1 inhibits ferroptosis by regulating FTO-mediated m6A methylation and SLC7A11 mRNA stability during glioblastoma progression

Authors - Qianting Tian
Loading...
||
New chat

Able

正在加载,请稍候...