Cystatin C Monoclonal antibody

Cystatin C Monoclonal Antibody for ELISA

Cat No. 66355-1-Ig
Clone No.2E6F3

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

ELISA

ARMD11, CST3, Cystatin 3, Cystatin C, Gamma trace, Post gamma globulin

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66355-1-Ig targets Cystatin C in ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24884

Product name: Recombinant human Cystatin C protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 25-146 aa of BC013083

Sequence: AGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA

Predict reactive species
Full Name cystatin C
Calculated Molecular Weight 146 aa, 16 kDa
GenBank Accession NumberBC013083
Gene Symbol Cystatin C
Gene ID (NCBI) 1471
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01034
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cystatin C is a 13-kDa inhibitor of cysteine proteinases which is secreted by all cell types and is completely cleared from the organism through glomerular filtration, shown to be an early and sensitive biomarker of renal dysfunction. It is also used as an emerging biomarker in cardiovascular disease. Cystatin C is involved in a variety of inflammatory reactions. The concentration of serum cystatin C has also been shown to be unaltered in certain inflammatory conditions or other disorders of metabolism. The plasma level of serum cystatin C can be expressed as its level of generation from cells and diet and its subsequent elimination through the gut, liver, and kidneys.

Loading...
||
New chat Able
正在加载,请稍候...