Tested Applications
Positive WB detected in | U-87 MG cells, human liver tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:300-1:600 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 2 publications below |
Product Information
14490-1-AP targets DBI in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag5891 Product name: Recombinant human DBI protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC062996 Sequence: MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKY Predict reactive species |
Full Name | diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) |
Calculated Molecular Weight | 10 kDa |
Observed Molecular Weight | 10 kDa |
GenBank Accession Number | BC062996 |
Gene Symbol | ACBP/DBI |
Gene ID (NCBI) | 1622 |
RRID | AB_2211037 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P07108 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DBI antibody 14490-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Rep Thioesterase induction by 2,3,7,8-tetrachlorodibenzo-p-dioxin results in a futile cycle that inhibits hepatic β-oxidation. | ||
Eur Neuropsychopharmacol Deficiency of prolyl oligopeptidase in mice disturbs synaptic plasticity and reduces anxiety-like behaviour, body weight, and brain volume. | ||
Hum Reprod Palmitic acid impairs human and mouse placental function by inhibiting trophoblast autophagy through induction of acyl-coenzyme A-binding protein (ACBP) upregulation |