Tested Applications
| Positive WB detected in | HepG2 cells, mouse brain tissue, rat brain tissue |
| Positive IHC detected in | human stomach cancer tissue, human liver tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12451-1-AP targets DBT in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3101 Product name: Recombinant human DBT protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC016675 Sequence: MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQG Predict reactive species |
| Full Name | dihydrolipoamide branched chain transacylase E2 |
| Calculated Molecular Weight | 482 aa, 53 kDa |
| Observed Molecular Weight | 53 kDa |
| GenBank Accession Number | BC016675 |
| Gene Symbol | DBT |
| Gene ID (NCBI) | 1629 |
| RRID | AB_2089636 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P11182 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DBT antibody 12451-1-AP | Download protocol |
| IHC protocol for DBT antibody 12451-1-AP | Download protocol |
| WB protocol for DBT antibody 12451-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DBT Polyclonal antibody (Cat# 12451-1-AP) has 16 total citations. These appear in journals including Cell Metabolism, Nature Metabolism, Redox Biology, Journal of Experimental & Clinical Cancer Research, Frontiers in Immunology, Journal of Thrombosis and Haemostasis, Molecular Medicine Reports, FASEB Journal, Journal of Nutrition, Journal of Inherited Metabolic Disease, Journal of Cancer Research and Clinical Oncology, Heliyon, and bioRxiv. Research fields span BCAA metabolism, cardiac hypertrophy, skeletal muscle atrophy, cancer, thrombocytopoiesis, Alzheimer's disease, ferroptosis, and mTOR signaling.
| Species | Application | Title |
|---|---|---|
Cell Metab Extra-cardiac BCAA catabolism lowers blood pressure and protects from heart failure | ||
Nat Metab Branched-chain amino acid catabolism in muscle affects systemic BCAA levels but not insulin resistance | ||
Redox Biol Txnrd2 loss in skeletal muscle causes muscle atrophy and drives leanness and obesity resistance. | ||
J Exp Clin Cancer Res Acetylation-induced degradation of ECHS1 enhances BCAA accumulation and proliferation in KRAS-mutant colorectal cancer | ||
Front Immunol Overexpression of DBT suppresses the aggressiveness of renal clear cell carcinoma and correlates with immune infiltration | ||
J Thromb Haemost Branched-chain amino acids promote thrombocytopoiesis by activating mTOR signaling |
Reviews
What customers say
One reviewer (Maria Lopez) rated this product 5/5 stars for Western Blot on human primary fibroblasts. She used 10 µg total protein on a 4–15% TGX gel with 3% BSA blocking in PBST. The primary antibody was applied at 1:1000 overnight at 4°C, and the HRP-conjugated secondary at 1:5000 for 1 hour at room temperature. Overall, the review reflects a successful WB experiment with clear protocol details and a top rating.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Maria (Verified Customer) (08-15-2021) | DBT in human primary fibroblasts. 10 ug of total protein. 4-15% TGX gel. Blocking 3% BSA in PBST (0.1% Tween). 1:1000 primary ab O/N incubation at 4ºC. 1:5000 secondary ab HRP conj. 1h RT in BSA 3% in PBST.
 |
