Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

DCBLD2 Polyclonal antibody

DCBLD2 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13168-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

CLCP1, CUB, LCCL and coagulation factor V/VIII-homology domains protein 1, Discoidin, CUB and LCCL domain-containing protein 2, Endothelial and smooth muscle cell-derived neuropilin-like protein, ESDN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inMKN-45 cells, human liver tissue, human brain tissue, SW 1990 cells, A549 cells, U2OS cells
Positive IP detected inU2OS cells
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13168-1-AP targets DCBLD2 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3821

Product name: Recombinant human DCBLD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 519-743 aa of BC029658

Sequence: YDLPYWDRAGFYLMVSLACRHNEGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL

Predict reactive species
Full Name discoidin, CUB and LCCL domain containing 2
Calculated Molecular Weight 775 aa, 89 kDa
Observed Molecular Weight93 kDa, 127 kDa
GenBank Accession NumberBC029658
Gene Symbol DCBLD2
Gene ID (NCBI) 131566
RRIDAB_2292662
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96PD2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCBLD2 (also known as CLCP1 or ESDN) is a transmembrane protein belonging to the DCBLD family, characterized by extracellular discoidin, CUB, and LCCL domains. It plays roles in cell adhesion, signaling, and vascular biology, with emerging implications in cancer progression, angiogenesis, and cardiovascular diseases. DCBLD2 is upregulated in certain tumors (e.g., glioblastoma, lung cancer) and may regulate receptor tyrosine kinase (RTK) pathways, including EGFR and PDGFR. Its exact mechanisms remain under investigation, but it is suggested to influence cell migration, proliferation, and tumor microenvironment interactions. The human DCBLD2 protein has a predicted molecular mass of ∼80 kDa based on its amino acid sequence, although it regularly displays an effective molecular mass of ∼130 kDa via SDS-PAGE (PMID: 30902898).

Protocols

Product Specific Protocols
IHC protocol for DCBLD2 antibody 13168-1-APDownload protocol
IP protocol for DCBLD2 antibody 13168-1-APDownload protocol
WB protocol for DCBLD2 antibody 13168-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Environ Toxicol

Comprehensive analyses and experimental verification of NETs and an EMT gene signature for prognostic prediction, immunotherapy, and chemotherapy in pancreatic adenocarcinoma

Authors - Jing Zhang
  • KD Validated
humanWB

J Mol Histol

miR-34c-3p promotes osteogenic differentiation of BMSCs by inhibiting DCBLD2 activation of the PI3K/AKT signaling pathway.

Authors - Yongcheng Deng
  • KD Validated
humanWB,IHC

Am J Cancer Res

In silico development and in vitro validation of a novel five-gene signature for prognostic prediction in colon cancer

Authors - Qiankun Zhu
mouseWB

Aging (Albany NY)

Plumbagin has an inhibitory effect on the growth of TSCC PDX model and it enhances the anticancer efficacy of cisplatin

Authors - Yuqi Xin
Loading...
||
New chat

Able

正在加载,请稍候...