• Featured Product
  • KD/KO Validated

DCDC2 Polyclonal antibody

DCDC2 Polyclonal Antibody for WB, IHC, IF-P, ELISA
Cat No. 26978-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

DCDC2A, Doublecortin domain-containing protein 2, Protein RU2S, RU2, RU2S

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse placenta tissue, HepG2 cells
Positive IHC detected inhuman Hepatocellular carcinoma
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman liver cancer tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26978-1-AP targets DCDC2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25577

Product name: Recombinant human DCDC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 351-476 aa of BC050704

Sequence: EDGEKANKDAEQKEDFSGMNGDLEEEGGREATDAPEQVEEILDHSEQQARPARVNGGTDEENGEELQQVNNELQLVLDKERKSQGAGSGQDEADVDPQRPPRPEVKITSPEENENNQQNKDYAAVA

Predict reactive species
Full Name doublecortin domain containing 2
Calculated Molecular Weight 476 aa, 53 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC050704
Gene Symbol DCDC2
Gene ID (NCBI) 51473
RRIDAB_2880709
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UHG0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCDC2 (Doublecortin domain-containing protein 2), also known as KIAA1154. DCDC2 is expressed in the central nervous system of adults and fetuses, especially in the olfactory cortex, inferior temporal cortex, medial temporal cortex, hypothalamus, amygdala and hippocampus. DCDCDC2 protein contains two dicortical protein domains that bind to microtubules and enhance microtubule polymerization, which may play a role in neuronal migration and affect the signal transduction of primary cilia. In addition, DCDC2 also plays a role in inhibiting classical WNT signaling. DCDC2 may affect the development and function of the brain by affecting the migration of neurons and the signal conduction of primary cilia, and then it is related to reading ability (PMID: 21457949). The molecular weight of DCDC2 is 52 kDa, it also has another isoform with a molecular weight of 25 kDa.

Protocols

Product Specific Protocols
IF protocol for DCDC2 antibody 26978-1-APDownload protocol
IHC protocol for DCDC2 antibody 26978-1-APDownload protocol
WB protocol for DCDC2 antibody 26978-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Physiol Genomics

Polycystin-2-dependent transcriptome reveals early response of autosomal dominant polycystic kidney disease

Authors - Hyun Jun Jung
mouse,humanWB,IHC,IF

Sci Rep

DCDC2 inhibits hepatic stellate cell activation and ameliorates CCl4-induced liver fibrosis by suppressing Wnt/β-catenin signaling

Authors - Qing-Qing Liu
ratIF

Front Immunol

TAK1 inhibition mitigates intracerebral hemorrhage-induced brain injury through reduction of oxidative stress and neuronal pyroptosis via the NRF2 signaling pathway

Authors - Jing Zhao
Loading...
||
New chat Able
正在加载,请稍候...