Tested Applications
Positive WB detected in | rat brain tissue, mouse lung tissue, mouse testis tissue |
Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:4000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 6 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
IP | See 1 publications below |
Product Information
25203-1-AP targets DDHD2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18373 Product name: Recombinant human DDHD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 56-174 aa of BC010504 Sequence: MDQGDTPTLEEDLKKLQLSEFFDIFEKEKVDKEALALCTDRDLQEIGIPLGPRKKILNYFSTRKNSMGIKRPAPQPASGANIPKESEFCSSSNTRNGDYLDVGIGQVSVKYPRLIYKPE Predict reactive species |
Full Name | DDHD domain containing 2 |
Calculated Molecular Weight | 711 aa, 81 kDa |
Observed Molecular Weight | 80-90 kDa |
GenBank Accession Number | BC010504 |
Gene Symbol | DDHD2 |
Gene ID (NCBI) | 23259 |
RRID | AB_2879957 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O94830 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDHD2, also known as KIAA0725p, is a member of the intracellular phospholipase A1 (PLA1) protein family which comprises a group of enzymes that hydrolyze the sn-1 ester bond of phospholipids, producing 2-acyl-lysophospholipids and fatty acids. DDHD2 prefers phosphatidic acid as substrate and has a role in efficient membrane trafficking from the Golgi apparatus to the plasma membrane. The gene of DDHD2 maps to chromosome 8p11.23, and encodes a 711-amino-acid protein with a calculated molecular mass of 81 kDa. It has been reported that DDHD2 immunoblot analysis of various tissue extracts revealed two bands of 90 and 85 kDa (PMID: 11788596).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for DDHD2 antibody 25203-1-AP | Download protocol |
IHC protocol for DDHD2 antibody 25203-1-AP | Download protocol |
IF protocol for DDHD2 antibody 25203-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Protein Cell Proteomic analysis of ferroptosis pathways reveals a role of CEPT1 in suppressing ferroptosis | ||
Neuron Rewiring Neuronal Glycerolipid Metabolism Determines the Extent of Axon Regeneration.
| ||
J Biol Chem The phospholipase PNPLA7 functions as a lysophosphatidylcholine hydrolase and interacts with lipid droplets through its catalytic domain. | ||
Cell Death Dis Circular RNA circRUNX1 promotes papillary thyroid cancer progression and metastasis by sponging MiR-296-3p and regulating DDHD2 expression.
| ||
J Lipid Res Cooperative lipolytic control of neuronal triacylglycerol by spastic paraplegia-associated enzyme DDHD2 and ATGL | ||
EMBO J The DDHD2-STXBP1 interaction mediates long-term memory via generation of saturated free fatty acids
|