×
Use Able AI chat for product recommendations

DDX19B Polyclonal antibody

DDX19B Polyclonal Antibody for WB, IP, ELISA

Cat No. 18285-1-AP
Publications(1)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, ELISA

Synonyms

DBP5, DDX19, DDX19B, DEAD box protein 19B, DEAD box RNA helicase DEAD5, RNAh

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of K-562 cells using DDX19B Polyclonal antibody (18285-1-AP)

    WB analysis of K-562 using 18285-1-AP

    K-562 cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HEK-293 cells using DDX19B Polyclonal antibody (18285-1-AP)

    WB analysis of HEK-293 using 18285-1-AP

    HEK-293 cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of NIH/3T3 cells using DDX19B Polyclonal antibody (18285-1-AP)

    WB analysis of NIH/3T3 using 18285-1-AP

    NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using DDX19B Polyclonal antibody (18285-1-AP)

    WB analysis of HeLa using 18285-1-AP

    HeLa cells were subjected to SDS PAGE followed by western blot with 18285-1-AP (DDX19B antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of K-562 cells using DDX19B Polyclonal antibody (18285-1-AP)

    IP experiment of K-562 using 18285-1-AP

    IP result of anti-DDX19B (IP:18285-1-AP, 4ug; Detection:18285-1-AP 1:500) with K-562 cells lysate 4000ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Tested Applications

Positive WB detected inK-562 cells, HEK-293 cells, HeLa cells, NIH/3T3 cells
Positive IP detected inK-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18285-1-AP targets DDX19B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13165

Product name: Recombinant human DDX19B protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-370 aa of BC010008

Sequence: MGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-As) box polypeptide 19B
Calculated Molecular Weight479aa,54 kDa; 370aa,42 kDa
Observed Molecular Weight 54 kDa
GenBank Accession NumberBC010008
Gene Symbol DDX19B
Gene ID (NCBI) 11269
RRIDAB_10597088
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UMR2
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IHC protocol for DDX19B antibody 18285-1-APDownload protocol
IP protocol for DDX19B antibody 18285-1-APDownload protocol
WB protocol for DDX19B antibody 18285-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Acta Neuropathol Commun

Inefficient quality control of ribosome stalling during APP synthesis generates CAT-tailed species that precipitate hallmarks of Alzheimer's disease

Authors - Suman Rimal
View Article
||
New chat

Able™

正在加载，请稍候...