DEFA1 Polyclonal antibody

DEFA1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 18057-1-AP

Publications(4)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, CoIP, ELISA

Synonyms

HP 1-56, HNP-1, defensin, alpha 1, DEFA2, DEFA1B

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIHCIF/ICC

WB analysis of HepG2 using 18057-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 18057-1-AP (DEFA1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human small intestine using 18057-1-AP
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human small intestine using 18057-1-AP
Immunohistochemical analysis of paraffin-embedded human small intestine tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 18057-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 18057-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 18057-1-AP (DEFA1 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 18057-1-AP
Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 18057-1-AP (DEFA1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (4)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HepG2 cells
Positive IHC detected in	human small intestine tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:200-1:1000
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:20-1:200
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18057-1-AP targets DEFA1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12592 Product name: Recombinant human DEFA1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-94 aa of BC093791 Sequence: MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGSRKNMACYCRIPACIAGERRYGTCIYQGRLWAFCC Predict reactive species
Full Name	defensin, alpha 1
Calculated Molecular Weight	94 aa, 10 kDa
Observed Molecular Weight	6 kDa
GenBank Accession Number	BC093791
Gene Symbol	DEFA1
Gene ID (NCBI)	1667
RRID	AB_2292842
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P59665
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for DEFA1 antibody 18057-1-AP	Download protocol
IHC protocol for DEFA1 antibody 18057-1-AP	Download protocol
WB protocol for DEFA1 antibody 18057-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB,CoIP	Life Sci DEFA1B inhibits ZIKV replication and retards cell cycle progression through interaction with ORC1. Authors - Shuang Li View Article
human	WB	Hum Cell Histone deacetylase 6-mediated downregulation of TMEM100 expedites the development and progression of non-small cell lung cancer. Authors - Yanyun Wang View Article
human	IHC	Syst Biol Reprod Med Identification of differentially expressed proteins associated with recurrence in ovarian endometriotic cysts. Authors - Genhai Zhu View Article
human	WB	Mediators Inflamm Potential Association of Gut Microbial Metabolism and Circulating mRNA Based on Multiomics Sequencing Analysis in Fetal Growth Restriction Authors - Hui Tang View Article