Tested Applications
Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 5 publications below |
IHC | See 3 publications below |
ELISA | See 1 publications below |
Product Information
14738-1-AP targets DEFB1 in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag6406 Product name: Recombinant human DEFB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC047677 Sequence: MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK Predict reactive species |
Full Name | defensin, beta 1 |
Calculated Molecular Weight | 7 kDa |
GenBank Accession Number | BC047677 |
Gene Symbol | DEFB1 |
Gene ID (NCBI) | 1672 |
RRID | AB_2091826 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P60022 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for DEFB1 antibody 14738-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Sci Rep β-defensin 1 expression in HCV infected liver/liver cancer: an important role in protecting HCV progression and liver cancer development. | ||
Indian J Gastroenterol Antibacterial spectrum of human omentum and differential expression of beta defensins. | ||
Cureus Expression of Antimicrobial Peptides and Cytokines in Human Omentum Following Abdominal Surgery | ||
Biomed Pharmacother Shen Qi Wan ameliorates nephritis in chronic kidney disease via AQP1 and DEFB1 regulation | ||
Int Immunopharmacol Edaravone alleviates Pseudomonas aeruginosa associated-acute lung injury by inhibiting inflammation and promoting anti-microbial peptide production | ||
Clin Proteomics Multi-omics analyses, cell experiments, and network pharmacology tools identified key proteins and candidate drugs for alopecia areata treatment |