DENND1A Polyclonal antibody

DENND1A Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 25658-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Connecdenn, Connecdenn 1, DENN domain-containing protein 1A, DENN/MADD domain containing 1A, FAM31A

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of SKOV-3 using 25658-1-AP
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 25658-1-AP (DENND1A Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 25658-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 25658-1-AP (DENND1A antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 25658-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 25658-1-AP (DENND1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 25658-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 25658-1-AP (DENND1A Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of K-562 using 25658-1-AP
IP result of anti-DENND1A (IP:25658-1-AP, 4ug; Detection:25658-1-AP 1:600) with K-562 cells lysate 3200ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human endometrial cancer using 25658-1-AP
Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25658-1-AP (DENND1A antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human endometrial cancer using 25658-1-AP
Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 25658-1-AP (DENND1A antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of SKOV-3 using 25658-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed SKOV-3 cells using DENND1A antibody (25658-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	SKOV-3 cells, A2780 cells, K-562 cells
Positive IP detected in	K-562 cells
Positive IHC detected in	human endometrial cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	SKOV-3 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25658-1-AP targets DENND1A in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag22547 Product name: Recombinant human DENND1A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 451-559 aa of BC039703 Sequence: QKDIAENGCAPTPEEQLPKTAPSPLVEAKDPKLREDRRPITVHFGQVRPPRPHVVKRPKSNIAVEGRRTSVPSPEQNTIATPATLHILQKSITHFAAKFPTRGWTSSSH Predict reactive species
Full Name	DENN/MADD domain containing 1A
Calculated Molecular Weight	1009 aa, 111 kDa
Observed Molecular Weight	111 kDa, 64 kDa
GenBank Accession Number	BC039703
Gene Symbol	DENND1A
Gene ID (NCBI)	57706
RRID	AB_2880180
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q8TEH3
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DENND1A (DENN/MADD domain containing 1A), also known as Connecdenn,FAM31A or KIAA1608, is a 1,009 amino acid peripheral membrane protein. Recent studies has found DENND1A is strongly associated with PCOS (Polycystic ovary syndrome). DENND1A has several isoforms.This antibody(25658-1-AP) can recognize all the isoforms at 112 kDa, 52-64 kDa.

Protocols

Product Specific Protocols
IF protocol for DENND1A antibody 25658-1-AP	Download protocol
IHC protocol for DENND1A antibody 25658-1-AP	Download protocol
IP protocol for DENND1A antibody 25658-1-AP	Download protocol
WB protocol for DENND1A antibody 25658-1-AP	Download protocol