Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Desmin Polyclonal antibody

Desmin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 16520-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

DES

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse heart tissue, human heart tissue, rat heart tissue
Positive IP detected inmouse heart tissue
Positive IHC detected inhuman appendicitis tissue, human colon tissue, human heart tissue, human hysteromyoma tissue, human placenta tissue, human skeletal muscle tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inrat heart tissue, mouse heart tissue
Positive IF/ICC detected inC2C12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16520-1-AP targets Desmin in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, sheep
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9742

Product name: Recombinant human Desmin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 121-470 aa of BC032116

Sequence: NYIEKVRFLEQQNAALAAEVNRLKGREPTRVAELYEEELRELRRQVEVLTNQRARVDVERDNLLDDLQRLKAKLQEEIQLKEEAENNLAAFRADVDAATLARIDLERRIESLNEEIAFLKKVHEEEIRELQAQLQEQQVQVEMDMSKPDLTAALRDIRAQYETIAAKNISEAEEWYKSKVSDLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEASGYQDNIARLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQTYSALNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL

Predict reactive species
Full Name desmin
Calculated Molecular Weight 470 aa, 54 kDa
Observed Molecular Weight 52-53 kDa
GenBank Accession NumberBC032116
Gene Symbol Desmin
Gene ID (NCBI) 1674
RRIDAB_2292918
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17661
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Desmin is the main intermediate filament protein in skeletal and cardiac muscle cells and is essential for both the structural integrity and the survival of muscle cells. As an abundant muscle-specific protein, desmin has been widely used as a marker of muscle derived tumors. Anti-desmin is also valuable in the differential diagnosis of tumors of uncertain origin.

Protocols

Product Specific Protocols
IF protocol for Desmin antibody 16520-1-APDownload protocol
IHC protocol for Desmin antibody 16520-1-APDownload protocol
IP protocol for Desmin antibody 16520-1-APDownload protocol
WB protocol for Desmin antibody 16520-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIF

Signal Transduct Target Ther

The AKAP12-PKA axis regulates lipid homeostasis during alcohol-associated liver disease

Authors - Chandana Thimme Gowda
ratIF

Biofabrication

Bioreactor-based stem cell therapy for liver fibrosis

Authors - Mengchao Yan
mouseWB

Theranostics

miR-17-3p Contributes to Exercise-Induced Cardiac Growth and Protects against Myocardial Ischemia-Reperfusion Injury.

Authors - Jing Shi
mouseIF

Acta Physiol (Oxf)

Podocyte apoptosis in diabetic nephropathy by BASP1 activation of the p53 pathway via WT1.

Authors - Yingying Zhang
humanIF

Oxid Med Cell Longev

Tanreqing Injection Regulates Cell Function of Hypoxia-Induced Human Pulmonary Artery Smooth Muscle Cells (HPASMCs) through TRPC1/CX3CL1 Signaling Pathway.

Authors - Yonghong Xiang
humanWB

J Invest Dermatol

TRAF6 Activates Fibroblasts to Cancer-Associated Fibroblasts through FGF19 in Tumor Microenvironment to Benefit the Malignant Phenotype of Melanoma Cells.

Authors - Yeye Guo

Reviews

    4.7 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kamal (Verified Customer) (01-26-2024)

Antibody diluted in 1X PBS, dilution 1:50000, worked well for western blot analysis in mouse liver tissues.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:50000
  • Cell Tissue Type: Mouse liver tissue

Brice-Emmanuel (Verified Customer) (09-12-2023)

Perfect if you want to see bandes of degraded desmin. I diluted the antibody 1:5000 in NFDM5%.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/5000
  • Cell Tissue Type: Mouse Heart Tissue
Desmin Antibody Western Blot validation (1/5000 dilution) in Mouse Heart Tissue (Cat no:16520-1-AP)

Víctor (Verified Customer) (06-12-2023)

It is a good marker for muscle cells. Indeed, sarcomeric structures can be seen with this antibody. High specificity and low background.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Skeletal muscle cells obtained by direct cell reprogramming approaches
Desmin Antibody Immunofluorescence validation (1:500 dilution) in Skeletal muscle cells obtained by direct cell reprogramming approaches (Cat no:16520-1-AP)

Sarah (Verified Customer) (11-16-2019)

This antibody worked well for both WB (1:4000 for 1 hour) and IP (1.6ug Ab/ 500ug Protein)

  • Applications: Western Blot, Immunoprecipitation,
  • Primary Antibody Dilution: WB- 1:4000, IP- 1.6ug
  • Cell Tissue Type: C2C12 Cells
Desmin Antibody Western Blot,Immunoprecipitation, validation (WB- 1:4000, IP- 1.6ug dilution) in C2C12 Cells (Cat no:16520-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...