DIDO1 Polyclonal antibody

DIDO1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 10183-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

BYE1, C20orf158, DATF 1, DATF1, DATF-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inRaji cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10183-1-AP targets DIDO1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0237

Product name: Recombinant human DIDO1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 345-544 aa of BC000770

Sequence: ADGTDCTSIGTIEQKSSEDQGIKGRIEKAANPSGKKKLKIFQPVIEAPGASKCIGPGCCHVAQPDSVYCSNDCILKHAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGAQAGIKISSVHKRPAPEKKETTVKKAVVVPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKCSGKYLYSLHPSLIA

Predict reactive species
Full Name death inducer-obliterator 1
Calculated Molecular Weight 244 kDa
Observed Molecular Weight 300-350 kDa
GenBank Accession NumberBC000770
Gene Symbol DIDO1
Gene ID (NCBI) 11083
RRIDAB_2277375
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9BTC0
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DIDO1, also termed DATF-1, C20orf158, DATF1, KIAA0333 and DIO-1, is a putative transcription factor, weakly pro-apoptotic when overexpressed. It is a tumor suppressor. In mice, DIDO1 is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. The human DIDO1 is similar to the mouse gene and therefore is thought to be involved in apoptosis. DIDO1 has multiple isoforms with molecular weights of 243 kd, 129 kd, 59 kd, and 61 kd. DIDO1 undergoes various modifications, including phosphorylation and ubiquitination, resulting in a mainstream molecular weight of 300 kd.

Protocols

Product Specific Protocols
IF protocol for DIDO1 antibody 10183-1-APDownload protocol
IHC protocol for DIDO1 antibody 10183-1-APDownload protocol
WB protocol for DIDO1 antibody 10183-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...