Tested Applications
| Positive WB detected in | HeLa cells, mouse liver tissue, mouse lung tissue, rat lung tissue, rat liver tissue, C2C12 cells, C6 cells |
| Positive IP detected in | mouse lung tissue |
| Positive IHC detected in | human oesophagus cancer tissue, human lymphoma tissue, mouse brain tissue, mouse testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13174-1-AP targets DNAJB1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3830 Product name: Recombinant human DNAJB1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-340 aa of BC019827 Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI Predict reactive species |
| Full Name | DnaJ (Hsp40) homolog, subfamily B, member 1 |
| Calculated Molecular Weight | 340 aa, 40 kDa |
| Observed Molecular Weight | 37-40 kDa |
| GenBank Accession Number | BC019827 |
| Gene Symbol | DNAJB1 |
| Gene ID (NCBI) | 3337 |
| RRID | AB_2230742 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P25685 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DNAJB1 is a member of the heat shock 40 protein family and has been involved in a variety of cellular processes, including the proteasome pathway, endoplasmic reticulum stress and viral infection. DNAJB1-PRKACA gene fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DNAJB1 antibody 13174-1-AP | Download protocol |
| IF protocol for DNAJB1 antibody 13174-1-AP | Download protocol |
| IHC protocol for DNAJB1 antibody 13174-1-AP | Download protocol |
| IP protocol for DNAJB1 antibody 13174-1-AP | Download protocol |
| WB protocol for DNAJB1 antibody 13174-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Mouse anti-HSP70 (Clone 24), Cat# 13174-1-AP, has 40 citations published in journals including Nature Cell Biology, Nature Communications, Molecular Cell, Developmental Cell, PNAS, FASEB Journal, Cancer Letters, Phytomedicine, Frontiers in Immunology, and others. Research fields span protein quality control, chaperone-mediated proteostasis, heat shock response, cancer (hepatocellular, ovarian, gastric, pancreatic, colorectal), neurodegeneration (Alzheimer's, Huntington's, SCA3), drug-induced liver injury, inflammasome activation, aging, and viral infection.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Caspase-2 is a condensate-mediated deubiquitinase in protein quality control | ||
Nat Commun Identification of a HTT-specific binding motif in DNAJB1 essential for suppression and disaggregation of HTT | ||
Mol Cell An ATP13A1-assisted topogenesis pathway for folding multi-spanning membrane proteins | ||
Cancer Lett Distinct Immunophenotypic Profiles and Neutrophil Heterogeneity in Colorectal Cancer | ||
Phytomedicine Targeting HSP70 chaperones by rhein sensitizes liver cancer to artemisinin derivatives | ||
Reviews
What customers say
One reviewer (Ana Lopez, March 2021) gave this antibody a 5-star rating after using it for Western Blot on mouse liver and heart tissue. She used a 1:1000 dilution with overnight 4°C incubation in BSA 3% PBST, and an HRP-conjugated secondary antibody at 1:5000 for 1 hour at room temperature. Two bands were observed, confirming detection of DNJB1 in mouse samples with 10 µg of total protein loaded.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ana (Verified Customer) (03-11-2021) | DNJB1 in mouse samples. 10 ug of total protein. 1:1000 O/N 4ºC incubation in BSA 3% PBST. Secondary ab HRP conjugated 1:5000 1h RT. 2 bands observed.
 |
