• Featured Product
  • KD/KO Validated

DNAJB1 Polyclonal antibody

DNAJB1 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 13174-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Heat shock 40 kDa protein 1, hDj-1, Hdj1, hDj 1, DNAJ1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, mouse liver tissue, mouse lung tissue, rat lung tissue, rat liver tissue, C2C12 cells, C6 cells
Positive IP detected inmouse lung tissue
Positive IHC detected inhuman oesophagus cancer tissue, human lymphoma tissue, mouse testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13174-1-AP targets DNAJB1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3830

Product name: Recombinant human DNAJB1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-340 aa of BC019827

Sequence: MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI

Predict reactive species
Full Name DnaJ (Hsp40) homolog, subfamily B, member 1
Calculated Molecular Weight 340 aa, 40 kDa
Observed Molecular Weight 37-40 kDa
GenBank Accession NumberBC019827
Gene Symbol DNAJB1
Gene ID (NCBI) 3337
RRIDAB_2230742
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP25685
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNAJB1 is a member of the heat shock 40 protein family and has been involved in a variety of cellular processes, including the proteasome pathway, endoplasmic reticulum stress and viral infection. DNAJB1-PRKACA gene fusions have been considered diagnostic for fibrolamellar hepatocellular carcinoma.

Protocols

Product Specific Protocols
FC protocol for DNAJB1 antibody 13174-1-APDownload protocol
IF protocol for DNAJB1 antibody 13174-1-APDownload protocol
IHC protocol for DNAJB1 antibody 13174-1-APDownload protocol
IP protocol for DNAJB1 antibody 13174-1-APDownload protocol
WB protocol for DNAJB1 antibody 13174-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Nat Cell Biol

Caspase-2 is a condensate-mediated deubiquitinase in protein quality control

Authors - Yingwei Ge
ratIF

Dev Cell

Nuclear import carrier Hikeshi cooperates with HSP70 to promote murine oligodendrocyte differentiation and CNS myelination

Authors - Li Li
humanWB

Proc Natl Acad Sci U S A

Local translation in nuclear condensate amyloid bodies.

Authors - Phaedra R Theodoridis
mouseWB

Mol Ther Nucleic Acids

Age-associated changes in microglia and astrocytes ameliorate blood-brain barrier dysfunction

Authors - Jie Pan
humanWB

Int J Mol Sci

PGC1α Promotes Cisplatin Resistance in Ovarian Cancer by Regulating the HSP70/HK2/VDAC1 Signaling Pathway.

Authors - Yanqing Li
WB

Front Oncol

A Prognostic Prediction Model Developed Based on Four CpG Sites and Weighted Correlation Network Analysis Identified DNAJB1 as a Novel Biomarker for Pancreatic Cancer.

Authors - Lingming Kong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Ana (Verified Customer) (03-11-2021)

DNJB1 in mouse samples. 10 ug of total protein. 1:1000 O/N 4ºC incubation in BSA 3% PBST. Secondary ab HRP conjugated 1:5000 1h RT. 2 bands observed.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Liver & Heart
DNAJB1 Antibody Western Blot validation (1:1000 dilution) in Mouse Liver & Heart (Cat no:13174-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...