Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis |
| Positive IHC detected in | mouse testis tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IF | See 1 publications below |
Product Information
25118-1-AP targets DNAJB13 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, canine samples.
| Tested Reactivity | human, mouse, rat, canine |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18934 Product name: Recombinant human DNAJB13 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 204-316 aa of BC153176 Sequence: PNIIPADIIFIVKEKLHPRFRRENDNLFFVNPIPLGKALTCCTVEVRTLDDRLLNIPINDIIHPKYFKKVPGEGMPLPEDPTKKGDLFIFFDIQFPTRLTPQKKQMLRQALLT Predict reactive species |
| Full Name | DnaJ (Hsp40) related, subfamily B, member 13 |
| Calculated Molecular Weight | 316 aa, 36 kDa |
| Observed Molecular Weight | 32-36 kDa |
| GenBank Accession Number | BC153176 |
| Gene Symbol | DNAJB13 |
| Gene ID (NCBI) | 374407 |
| RRID | AB_2879906 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P59910 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for DNAJB13 antibody 25118-1-AP | Download protocol |
| WB protocol for DNAJB13 antibody 25118-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Assist Reprod Genet A novel homozygous mutation in DNAJB13-a gene associated with the sperm axoneme-leads to teratozoospermia. | ||
Cell Rep Differential requirements of IQUB for the assembly of radial spoke 1 and the motility of mouse cilia and flagella |









