Home
Products
Primary Antibodies
DNAJC2/MPP11 Polyclonal antibody (11971-1-AP)

DNAJC2/MPP11 Polyclonal antibody

DNAJC2/MPP11 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11971-1-AP

Publications (2)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

DNAJC2, DnaJ homolog subfamily C member 2, N-terminally processed, M-phase phosphoprotein 11, MPHOSPH11, MPP11

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of K-562 using 11971-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11971-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 11971-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 11971-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 11971-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 11971-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 11971-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 11971-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 11971-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 11971-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 11971-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 11971-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 11971-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 11971-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 11971-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 11971-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 11971-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of K-562 using 11971-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 11971-1-AP (DNAJC2/MPP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse liver using 11971-1-AP
IP result of anti-DNAJC2/MPP11 (IP:11971-1-AP, 4ug; Detection:11971-1-AP 1:1000) with mouse liver tissue lysate 6000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 11971-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11971-1-AP (DNAJC2/MPP11 antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver cancer using 11971-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 11971-1-AP (DNAJC2/MPP11 antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 11971-1-AP
Immunofluorescent analysis of HepG2 cells, using DNAJC2 antibody 11971-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HeLa using 11971-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DNAJC2/MPP11 antibody (11971-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DNAJC2/MPP11 in ?

Overview

Tested Applications
Product Information
Publications (2)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	Caco-2 cells, HEK-293 cells, HeLa cells, HepG2 cells, K-562 cells, mouse liver tissue, PC-3 cells
Positive IP detected in	mouse liver tissue
Positive IHC detected in	human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HeLa cells, HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:1000-1:8000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:50-1:500
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11971-1-AP targets DNAJC2/MPP11 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag2594 Product name: Recombinant human MPP11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC056682 Sequence: MLLLPSAADGRGTAITHALTSASTLCQVEPVGRWFEAFVKRRNRNASASFQELEDKKELSEESEDEELQLEEFPMLKTLDPKDWKNQDHYAVLGLGHVRYKATQRQIKAAHKAMVLKHHPDKRKAAGEPIKEGDNDYFTCITKGSPGDSYQKLILQLIHLMKCYLIQ Predict reactive species
Full Name	DnaJ (Hsp40) homolog, subfamily C, member 2
Calculated Molecular Weight	72 kDa
Observed Molecular Weight	66-75 kDa
GenBank Accession Number	BC056682
Gene Symbol	DNAJC2
Gene ID (NCBI)	27000
RRID	AB_10695893
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q99543
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for DNAJC2/MPP11 antibody 11971-1-AP	Download protocol
IHC protocol for DNAJC2/MPP11 antibody 11971-1-AP	Download protocol
IP protocol for DNAJC2/MPP11 antibody 11971-1-AP	Download protocol
WB protocol for DNAJC2/MPP11 antibody 11971-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-HSP70 (HSPA1) antibody (Cat# 11971-1-AP) has 2 total citations, both used for Western Blot in human samples. Citations appear in EMBO Journal (2021, IF 8.4) and Cancers (Basel) (2022, IF 4.8). The research fields covered include protein quality control and chaperone-mediated nascent protein folding, as well as mutant p53 depletion and HSP40/J-domain protein inhibition in cancer biology.

Species	Application	Title
human	WB	EMBO J Dual roles of HSP70 chaperone HSPA1 in quality control of nascent and newly synthesized proteins. Authors - Guiyou Tian View Article
human	WB	Cancers (Basel) Mutant p53 Depletion by Novel Inhibitors for HSP40/J-Domain Proteins Derived from the Natural Compound Plumbagin Authors - Mohamed Alalem View Article