Featured Product
KD/KO Validated

DNMT1 Polyclonal antibody

DNMT1 Polyclonal Antibody for WB, IP, ELISA

Cat No. 24206-1-AP

Publications (132)

Reviews (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (5)

Applications

WB, IP, CoIP, ChIP, RIP, ELISA

Synonyms

AIM, CXXC9, CXXC-type zinc finger protein 9, DNA (cytosine-5)-methyltransferase 1, DNMT

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIP

WB analysis using 24206-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 24206-1-AP (DNMT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 24206-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 24206-1-AP (DNMT1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of C6 using 24206-1-AP
C6 cells were subjected to SDS PAGE followed by western blot with 24206-1-AP (DNMT1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HEK-293 using 24206-1-AP
IP result of anti-DNMT1 (IP:24206-1-AP, 4ug; Detection:24206-1-AP 1:500) with HEK-293 cells lysate 1400 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DNMT1 in ?

Overview

Tested Applications
Product Information
Publications (132)
Protocols
Reviews (2)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, C6 cells, HEK-293 cells, HepG2 cells, Jurkat cells
Positive IP detected in	HEK-293 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:2000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24206-1-AP targets DNMT1 in WB, IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity	human, rat
Cited Reactivity	human, mouse, rat, pig, chicken, zebrafish, goat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag19116 Product name: Recombinant human DNMT1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1288-1632 aa of BC126227 Sequence: VSFKRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALEISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSDWRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKACDPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLAKAIGLEIKLCMLAKARESASAKIKEEEAAKD Predict reactive species
Full Name	DNA (cytosine-5-)-methyltransferase 1
Calculated Molecular Weight	1632 aa, 185 kDa
Observed Molecular Weight	180-200 kDa
GenBank Accession Number	BC126227
Gene Symbol	DNMT1
Gene ID (NCBI)	1786
RRID	AB_2879457
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P26358
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DNA methylation is a major epigenetic modification that regulates gene expression. DNMT1, the maintenance DNA methylation enzyme, is the primary enzyme responsible for copying methylation patterns after DNA replication. DNMT1 is required for X chromosome inactivation, imprinting, genomic methylation and proper embryonic development. Overexpression of DNMT1 has been reported in various cancers. DNMT1 exists some isoforms with MW 184 kDa and 145 kDa. (PMID: 10753866)

Protocols

Product Specific Protocols
IP protocol for DNMT1 antibody 24206-1-AP	Download protocol
WB protocol for DNMT1 antibody 24206-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

24206-1-AP is an anti-DNMT1 affinity purification antibody with 132 total citations. Citations appear across 80+ journals, including Nature Cancer, Molecular Cancer, Advanced Science, Cell Reports Medicine, EMBO Journal, Science Advances, Cancer Letters, Free Radical Biology and Medicine, and Journal of Translational Medicine. Associated research fields predominantly cover epigenetics/DNA methylation, oncology (hepatocellular, lung, colorectal, breast, prostate, and ovarian cancers), cardiology, neurology, reproductive biology, immunology, and animal nutrition.

Species	Application	Title
human	WB	Mol Cancer Crosstalk between 5-methylcytosine and N6-methyladenosine machinery defines disease progression, therapeutic response and pharmacogenomic landscape in hepatocellular carcinoma Authors - Yu Tian View Article
		Nat Cancer CDK10 suppresses nucleic acid sensors-mediated antitumor immunity Authors - Gaoshan Xu View Article
human	WB,ChIP	Bioact Mater Matrix stiffness exacerbates the proinflammatory responses of vascular smooth muscle cell through the DDR1-DNMT1 mechanotransduction axis. Authors - Jin Wang KO Validated View Article
human, mouse	WB	J Adv Res UHRF1-mediated DNA 5-mC modification drives super-enhancer redistribution and impedes osteogenesis via TGM2-regulated autophagic flux in senile osteoporosis. Authors - Peizhuo Pang View Article
human	WB	Redox Biol DNMT1-DUOXA1 axis discovers a novel methylation-ferroptosis circuit in bicalutamide-resistant prostate cancer. Authors - Shunyao Xia KD Validated View Article
human	WB	Theranostics Targeting CPS1 attenuates lung cancer metastasis by regulating EMT through an epigenetic mechanism. Authors - Yi Ding View Article

Reviews

4.0 out of 5

Add a review

2 verified customer reviews

What customers say

Users report clear bands at the expected molecular weight in Western Blot applications. One reviewer (5/5) used a 1/1000 dilution on HeLa cells with a 1-hour room temperature incubation and observed a great band at the expected size. Another reviewer (3/5) used a 1:500 dilution on fetal rat lung tissue and noted good bands at the right molecular weight but significant background smear. Overall, the antibody performs well for target detection, though some users may experience elevated background depending on tissue type.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Roy (Verified Customer) (09-17-2025)	Great band at the expected size. The dilution used was 1/1000 with an 1h incubation at Room Temperature Applications: Western Blot Primary Antibody Dilution: 1/1000 Cell Tissue Type: HeLa DNMT1 Antibody Western Blot validation (1/1000 dilution) in HeLa (Cat no:24206-1-AP)
Paula (Verified Customer) (12-14-2021)	good bands at the right molecular weight, but a lot of smear Applications: Western Blot Primary Antibody Dilution: 1:500 Cell Tissue Type: fetal rat lung tissue DNMT1 Antibody Western Blot validation (1:500 dilution) in fetal rat lung tissue (Cat no:24206-1-AP)