Tested Applications
| Positive WB detected in | HeLa cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | mouse pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | K-562 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25326-1-AP targets DYNC1LI1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18191 Product name: Recombinant human DYNC1LI1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 167-233 aa of BC131620 Sequence: SVVREHVDKLKIPPEEMKQMEQKLIRDFQEYVEPGEDFPASPQRRNTASQEDKDDSVVLPLGADTLT Predict reactive species |
| Full Name | dynein, cytoplasmic 1, light intermediate chain 1 |
| Calculated Molecular Weight | 523 aa, 57 kDa |
| Observed Molecular Weight | 57-60 kDa |
| GenBank Accession Number | BC131620 |
| Gene Symbol | DYNC1LI1 |
| Gene ID (NCBI) | 51143 |
| RRID | AB_2880031 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6G9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DYNC1LI1 antibody 25326-1-AP | Download protocol |
| IHC protocol for DYNC1LI1 antibody 25326-1-AP | Download protocol |
| WB protocol for DYNC1LI1 antibody 25326-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
| Species | Application | Title |
|---|---|---|
Anal Chem Ionic Liquid-Based Extraction System for In-Depth Analysis of Membrane Protein Complexes. | ||
Cell Death Differ USP21-mediated deubiquitylation stimulates NuMA recruitment to the cell cortex to promote mitotic spindle orientation. | ||
Nat Chem Biol A small molecule targets LIC1 to suppress lung tumor growth by inducing autophagy. |















