Tested Applications
| Positive WB detected in | A431 cells, human heart tissue, mouse brain tissue, rat brain tisssue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
| IHC | See 1 publications below |
| IF | See 2 publications below |
| CoIP | See 1 publications below |
Product Information
16811-1-AP targets DYNLL2 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10345 Product name: Recombinant human DYNLL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-89 aa of BC010744 Sequence: MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG Predict reactive species |
| Full Name | dynein, light chain, LC8-type 2 |
| Calculated Molecular Weight | 89 aa, 10 kDa |
| Observed Molecular Weight | 10 kDa |
| GenBank Accession Number | BC010744 |
| Gene Symbol | DYNLL2 |
| Gene ID (NCBI) | 140735 |
| RRID | AB_2093667 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96FJ2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DYNLL2 antibody 16811-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Curr Biol CCDC176 stabilizes microtubule doublets 1 and 9 to ensure proper sperm movement | ||
Elife LRRC23 truncation impairs radial spoke 3 head assembly and sperm motility underlying male infertility | ||
Anal Chem Ionic Liquid-Based Extraction System for In-Depth Analysis of Membrane Protein Complexes. | ||
Cell Cycle Tctex1d2 associates with short-rib polydactyly syndrome proteins and is required for ciliogenesis. | ||
Front Oncol TRIM68, PIKFYVE, and DYNLL2: The Possible Novel Autophagy- and Immunity-Associated Gene Biomarkers for Osteosarcoma Prognosis. | ||
Biochim Biophys Acta Mol Cell Res Interactions between two regulatory proteins of microtubule dynamics, HDAC6, TPPP/p25, and the hub protein, DYNLL/LC8. |





