Filter: AllWBIHC

WB analysis using 12580-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 12580-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
WB analysis of COLO 320 using 12580-1-AP
COLO 320 cells were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of mouse brain using 12580-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
WB analysis of HepG2 using 12580-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
WB analysis of mouse lung using 12580-1-AP
mouse lung tissue were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.
WB analysis of human lung using 12580-1-AP
human lung tissue were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 12580-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
WB analysis of K-562 using 12580-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 12580-1-AP (EDIL3 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
IHC staining of human pancreas cancer using 12580-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12580-1-AP (EDIL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human pancreas cancer using 12580-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 12580-1-AP (EDIL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human liver cancer using 12580-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer using 12580-1-AP (EDIL3 antibody) at dilution of 1:50 (under 10x lens).
IHC staining of human liver cancer using 12580-1-AP
Immunohistochemical analysis of paraffin-embedded human liver cancer using 12580-1-AP (EDIL3 antibody) at dilution of 1:50 (under 40x lens).
IHC staining of human lung cancer using 12580-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12580-1-AP (EDIL3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 12580-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12580-1-AP (EDIL3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

EDIL3 Polyclonal antibody

Name: EDIL3 Polyclonal antibody
Brand: Proteintech
SKU: 12580-1-AP
Rating: 5.00 (1 reviews)

EDIL3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12580-1-AP

Publications(19)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, CoIP, ELISA

Synonyms

DEL1, Developmentally-regulated endothelial cell locus 1 protein, EGF-like repeat and discoidin I-like domain-containing protein 3, Integrin-binding protein DEL1

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (19)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293 cells, COLO 320 cells, mouse brain tissue, HepG2 cells, mouse lung tissue, human lung tissue, HeLa cells, K-562 cells
Positive IHC detected in	human pancreas cancer tissue, human lung cancer tissue, human liver cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunohistochemistry (IHC)	IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

KD/KO	See 5 publications below
WB	See 9 publications below
IHC	See 5 publications below
IF	See 4 publications below
ELISA	See 1 publications below
CoIP	See 1 publications below

Product Information

12580-1-AP targets EDIL3 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag3274 Product name: Recombinant human EDIL3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 131-480 aa of BC030828 Sequence: GGICTDLVANYSCECPGEFMGRNCQYKCSGPLGIEGGIISNQQITASSTHRALFGLQKWYPYYARLNKKGLINAWTAAENDRWPWIQINLQRKMRVTGVITQGAKRIGSPEYIKSYKIAYSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE Predict reactive species
Full Name	EGF-like repeats and discoidin I-like domains 3
Calculated Molecular Weight	52 kDa
Observed Molecular Weight	52-55 kDa
GenBank Accession Number	BC030828
Gene Symbol	EDIL3
Gene ID (NCBI)	10085
RRID	AB_2096219
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O43854
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EGF-like repeats and discoidin I-like domain-containing protein 3 (EDIL3), also named as DEL1 or integrin-biding protein DEL1, is a 52-kDa extracellular matrix protein produced by endothelial cells in embryos (PMID: 9420328). It is composed of three EGF repeats and two discoidin I-like domains. The second EGF repeat contains an RGD motif. EDIL3 promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. It may be involved in vascular remodeling during angiogenesis (PMID: 12840057; 14981004). EDIL3 has also been reported to be an endogenous inhibitor of inflammatory cell recruitment by interfering with the integrin LFA-1-dependent leukocyte-endothelial adhesion (PMID: 19008446).

Protocols

Product Specific Protocols
IHC protocol for EDIL3 antibody 12580-1-AP	Download protocol
WB protocol for EDIL3 antibody 12580-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
mouse	IF	J Clin Invest Secreted protein Del-1 regulates myelopoiesis in the hematopoietic stem cell niche. Authors - Ioannis Mitroulis KO Validated View Article
human	ELISA	Nat Commun Antagonistic effects of IL-17 and D-resolvins on endothelial Del-1 expression through a GSK-3β-C/EBPβ pathway. Authors - Tomoki Maekawa View Article
human	WB,IHC	Oncotarget Overexpressed EDIL3 predicts poor prognosis and promotes anchorage-independent tumor growth in human pancreatic cancer. Authors - Shu-Heng Jiang KD Validated View Article
		Thromb Haemost Developmental endothelial locus-1 attenuates complement-dependent phagocytosis through inhibition of Mac-1-integrin. Authors - Ioannis Mitroulis View Article
		Sci Rep Inhibition of CDK9 as a therapeutic strategy for inflammatory arthritis. Authors - Annelie Hellvard View Article
human	WB, IHC	Mol Cancer Elevated autocrine EDIL3 protects hepatocellular carcinoma from anoikis through RGD-mediated integrin activation. Authors - Ming-Xuan Feng View Article