• Featured Product
  • KD/KO Validated

EHD1 Polyclonal antibody

EHD1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 24657-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Testilin, PAST1, PAST, EH domain-containing protein 1, EH domain containing 1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse lung tissue, mouse brain tissue, HeLa cells, mouse testis tissue, rat lung tissue
Positive IP detected inmouse testis tissue
Positive IHC detected inhuman stomach cancer tissue, human intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24657-1-AP targets EHD1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18400

Product name: Recombinant human EHD1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 353-422 aa of BC104799

Sequence: FPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQVVKGGAFDGTMNGPF

Predict reactive species
Full Name EH-domain containing 1
Calculated Molecular Weight 534 aa, 61 kDa
Observed Molecular Weight 61 kDa
GenBank Accession NumberBC104799
Gene Symbol EHD1
Gene ID (NCBI) 10938
RRIDAB_2879658
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H4M9
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EHD1 (Eps15 Homology Domain Containing 1) is a protein that plays a crucial role in endocytic recycling, which is the process by which cells recycle their membrane components. It is one of four paralogs in mammals (EHD1-4) and is involved in several membrane trafficking pathways. EHD1 is particularly well-studied and is known to regulate the recycling of various cell surface receptors back to the cell surface after they have been endocytosed. This process is essential for maintaining the proper distribution of receptors and other membrane proteins, which in turn affects cellular signaling and function. EHD1 has been implicated in the regulation of the transferrin receptor (TfR), major histocompatibility complex (MHC) class I proteins, β1 integrins, and other receptors. It has also been shown to interact with Rab11-FIP2 and is localized to peripheral endosomes, suggesting a role in the transport of receptors from early endosomes to the endocytic recycling compartment (ERC). Furthermore, EHD1 has been linked to dynein motors that drive transport from early endosomes to the ERC via a complex including MICAL-L1 and the collapsin response mediator protein-2 (Crmp2).

Protocols

Product Specific Protocols
WB protocol for EHD1 antibody 24657-1-APDownload protocol
IHC protocol for EHD1 antibody 24657-1-APDownload protocol
IP protocol for EHD1 antibody 24657-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

EMBO J

Insufficiency of ciliary cholesterol in hereditary Zellweger syndrome.

Authors - Tatsuo Miyamoto
  • KO Validated
mouseWB

Sci Rep

Rab35 and its effectors promote formation of tunneling nanotubes in neuronal cells.

Authors - Shaarvari Bhat
  • KD Validated
humanWB,IHC,IF

BMC Cancer

PMID: 27411790

Authors - Jing Gao
  • KD Validated
humanWB,IF

Biochem Biophys Res Commun

A novel CDK-independent function of p27Kip1 in preciliary vesicle trafficking during ciliogenesis.

Authors - Hiroki Yukimoto

J Extracell Vesicles

Breast Cancer-Derived Extracellular Vesicles Modulate the Cytoplasmic and Cytoskeletal Dynamics of Blood-Brain Barrier Endothelial Cells

Authors - Sara Busatto

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Olga (Verified Customer) (09-12-2025)

The blot is quite clear but a bit confusing that there are two bands in mouse cell lines and tissues.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse spleen, heart, lung, liver, forebrain; mouse primary cerebellar granule neurons; mouse cell lines Neuro2A and mHypo
EHD1 Antibody Western Blot validation (1:1000 dilution) in Mouse spleen, heart, lung, liver, forebrain; mouse primary cerebellar granule neurons; mouse cell lines Neuro2A and mHypo (Cat no:24657-1-AP)
FH

Kyosuke (Verified Customer) (06-12-2019)

I am working on thrombosis study. I use this for mouse platelet Western blot and it works very well.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: mouse platelet
FH

Juan (Verified Customer) (05-02-2019)

It works well with a single band

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000-1:2000
  • Cell Tissue Type: Hela cells
Loading...