Featured Product
KD/KO Validated

EIF2S2 Polyclonal antibody

EIF2S2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10227-1-AP

Publications(13)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Eukaryotic translation initiation factor 2 subunit 2, eIF2-beta, EIF2beta, EIF2B, EIF2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of mouse liver using 10227-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 10227-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 10227-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 10227-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 10227-1-AP
HEK-293T cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 10227-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse testis using 10227-1-AP
mouse testis tissue were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse liver using 10227-1-AP
mouse liver tissue were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 10227-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of L02 using 10227-1-AP
L02 cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 10227-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 10227-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HeLa using 10227-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of PC-3 using 10227-1-AP
PC-3 cells were subjected to SDS PAGE followed by western blot with 10227-1-AP (EIF2S2 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of mouse liver using 10227-1-AP
IP result of anti-EIF2S2 (IP:10227-1-AP, 4ug; Detection:10227-1-AP 1:1000) with mouse liver tissue lysate 4000ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 10227-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 10227-1-AP (EIF2S2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 10227-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 10227-1-AP (EIF2S2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human liver using 10227-1-AP
Immunohistochemical analysis of paraffin-embedded human liver using 10227-1-AP (EIF2S2 antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human testis using 10227-1-AP
Immunohistochemical analysis of paraffin-embedded human testis using 10227-1-AP (EIF2S2 antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 10227-1-AP
Immunofluorescent analysis of HepG2 cells, using EIF2S2 antibody 10227-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 10227-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EIF2S2 antibody (10227-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of L02 using 10227-1-AP
Immunofluorescent analysis of L02 cells using 10227-1-AP (EIF2S2 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (13)
Protocols
Reviews (1)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HEK-293T cells, mouse testis tissue, mouse liver tissue, L02 cells, HeLa cells, PC-3 cells, HepG2 cells, rat liver tissue, Jurkat cells, NIH/3T3 cells, C6 cells
Positive IP detected in	mouse liver tissue
Positive IHC detected in	human testis tissue, human liver tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells, L02 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10227-1-AP targets EIF2S2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Cited Reactivity	human, mouse
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0269 Product name: Recombinant human EIF2S2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-210 aa of BC000461 Sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVV Predict reactive species
Full Name	eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Calculated Molecular Weight	38 kDa
Observed Molecular Weight	50 kDa
GenBank Accession Number	BC000461
Gene Symbol	EIF2S2
Gene ID (NCBI)	8894
RRID	AB_2262043
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	P20042
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Eukaryotic translation initiation factor 2 (eIF2) is composed of three subunits, eIF2 alpha, eIF2 beta (EIF2S2), and eIF2 gamma, which are present in equal molar amounts. eIF2 beta plays a central role in the maintenance of what is generally considered a rate-limiting step in mRNA translation. In the early steps of protein synthesis, eIF2 beta binds GTP and Met-tRNA and transfers Met-tRNA to the 40S ribosomal subunit. At the end of the initiation process, GTP bound to eIF2 beta is hydrolyzed to GDP and the eIF2/GDP complex is released from the ribosome. The exchange of GDP bound to eIF2 beta for GTP is a prerequisite to binding Met-tRNA and is mediated by eIF2 beta, which recycles the eIF2 complex for another round of initiation.

Protocols

Product Specific Protocols
IF protocol for EIF2S2 antibody 10227-1-AP	Download protocol
IHC protocol for EIF2S2 antibody 10227-1-AP	Download protocol
IP protocol for EIF2S2 antibody 10227-1-AP	Download protocol
WB protocol for EIF2S2 antibody 10227-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Cancer Res Comparative oncogenomics identifies PSMB4 and SHMT2 as potential cancer driver genes. Authors - Genee Y Lee View Article
	WB	J Transl Med CAPN2 promotes apalutamide resistance in metastatic hormone-sensitive prostate cancer by activating protective autophagy Authors - Zihao Qi View Article
human	WB	Front Mol Biosci Comprehensive Characterization of Ageing-Relevant Subtypes Associated With Different Tumorigenesis and Tumor Microenvironment in Prostate Cancer. Authors - Liang Huang KD Validated View Article
mouse	IF	J Med Genet Bi-allelic variants in chromatoid body protein TDRD6 cause spermiogenesis defects and severe oligoasthenoteratozoospermia in humans Authors - Rui Guo View Article
human	WB,IHC	Biomol Ther (Seoul) Translation Initiation Factor-2S2 (eIF2S2) Contributes to Cervical Carcinogenesis by Inhibiting the TGF-β/SMAD4 Signaling Pathway Authors - Juthika Kundu View Article
mouse	WB	Neurogenetics Genetic ablation of ataxin-2 increases several global translation factors in their transcript abundance but decreases translation rate. Authors - M Fittschen View Article