Featured Product
KD/KO Validated

EIF3D Polyclonal antibody

EIF3D Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10219-1-AP

Publications(34)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, yeast and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA

Synonyms

Eukaryotic translation initiation factor 3 subunit 7, eIF-3-zeta, EIF3S7, eIF3 zeta, eIF3 p66

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICC

WB analysis of mouse brain using 10219-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis using 10219-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 10219-1-AP
WB result of EIF3D antibody (10219-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-EIF3D transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of A549 using 10219-1-AP
A549 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HepG2 using 10219-1-AP
HepG2 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of human brain using 10219-1-AP
human brain tissue were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of L02 using 10219-1-AP
L02 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of L02 using 10219-1-AP
L02 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of L02 using 10219-1-AP
L02 cells were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of mouse brain using 10219-1-AP
mouse brain tissue were subjected to SDS PAGE followed by western blot with 10219-1-AP (EIF3D antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of A549 using 10219-1-AP
IP result of anti-EIF3D (IP:10219-1-AP, 4ug; Detection:10219-1-AP 1:300) with A549 cells lysate 2800 ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10219-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10219-1-AP (EIF3D Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human breast cancer using 10219-1-AP
Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 10219-1-AP (EIF3D Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining using 10219-1-AP
IF result of 10219-1-AP (anti-EIF3D) in U2OS cell (treated with 100 mM sodium arsenite to cause stress-induced translational arrest) by Dr. Nancy Kedersha.U2OS cells (FAST-YFP stables; but not showing FAST-YFP); stained with PTG anti-eIF3p66 in green; and counterstained with anti-eIF3b (goat polyclonal) in red; nuclei stained blue using Hoechst.
IF Staining of HepG2 using 10219-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using EIF3D antibody (10219-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of transfected cells using 10219-1-AP
IF result of 10219-1-AP (anti-EIF3D) in U2OS cell by Dr. Nancy Kedersha. U2OS cells (FAST-YFP stables; but not showing FAST-YFP); stained with 10219-1-AP (EIF3D) in green; and counterstained with Santa Cruz anti-eIF3b (goat polyclonal) in red; nuclei stained blue using Hoechst.; The EIF3D(p66) appears associated with mitochondria.
IF Staining of HepG2 using 10219-1-AP
Immunofluorescent analysis of HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 10219-1-AP
Immunofluorescent analysis of Ethacrynic acid treated HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 10219-1-AP
Immunofluorescent analysis of HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 10219-1-AP
Immunofluorescent analysis of Ethacrynic acid treated HepG2 cells using 10219-1-AP (EIF3D antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of MCF-7 using 10219-1-AP
Immunofluorescent analysis of MCF-7 cells, using EIF3D antibody 10219-1-AP at 1:50 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). Blue pseudocolor = DAPI (fluorescent DNA dye).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Overview

Tested Applications
Product Information
Publications (34)
Protocols
Reviews (3)

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	mouse brain tissue, A549 cells, HepG2 cells, human brain tissue, L02 cells, HEK-293 cells, Jurkat cells
Positive IP detected in	A549 cells
Positive IHC detected in	human breast cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells, Ethacrynic acid treated HepG2 cells, transfected cells, N/A, MCF-7 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:1000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:20-1:200
Immunofluorescence (IF)/ICC	IF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10219-1-AP targets EIF3D in WB, IHC, IF/ICC, IP, CoIP, ELISA, PLA applications and shows reactivity with human, mouse, yeast samples.

Tested Reactivity	human, mouse, yeast
Cited Reactivity	human, mouse, rat, rabbit, yeast
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0268 Product name: Recombinant human EIF3D protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 323-531 aa of BC000328 Sequence: FSQQCLRMGKERYNFPNPNPFVEDDMDKNEIASVAYRYRRWKLGDDIDLIVRCEHDGVMTGANGEVSFINIKTLNEWDSRHCNGVDWRQKLDSQRGAVIATELKNNSYKLARWTCCALLAGSEYLKLGYVSRYHVKDSSRHVILGTQQFKPNEFASQINLSVENAWGILRCVIDICMKLEEGKYLILKDPNKQVIRVYSLPDGTFSSDE Predict reactive species
Full Name	eukaryotic translation initiation factor 3, subunit D
Calculated Molecular Weight	66 kDa
Observed Molecular Weight	66 kDa
GenBank Accession Number	BC000328
Gene Symbol	EIF3D
Gene ID (NCBI)	8664
RRID	AB_2096880
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	O15371
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian translation initiation factor 3 (eIF3), is a multiprotein complex of ~600 kDa that binds to the 40 S ribosome and promotes the binding of methionyl-tRNAi and mRNA. The EIF3S7(p66) is the major RNA binding subunit in this complex. Human eIF3-p66 shares 64% sequence identity with a hypothetical Caenorhabditis elegans protein, presumably the p66 homolog. Deletion analyses of recombinant derivatives of eIF3-p66 show that the RNA-binding domain lies within an N-terminal 71-amino acid region rich in lysine and arginine.

Protocols

Product Specific Protocols
IF protocol for EIF3D antibody 10219-1-AP	Download protocol
IHC protocol for EIF3D antibody 10219-1-AP	Download protocol
IP protocol for EIF3D antibody 10219-1-AP	Download protocol
WB protocol for EIF3D antibody 10219-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Species	Application	Title
human	WB	Cell Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules Authors - Qinqin Cui View Article
mouse	WB	Mol Cell Heterogeneous Ribosomes Preferentially Translate Distinct Subpools of mRNAs Genome-wide. Authors - Zhen Shi View Article
human	WB	Sci Adv EIF3D safeguards the homeostasis of key signaling pathways in human primed pluripotency Authors - Chikako Okubo View Article
human	WB	Nat Commun A translational program that suppresses metabolism to shield the genome. Authors - Nathan C Balukoff View Article
human	IHC	EBioMedicine PMID: 31669222 Authors - Hai Huang View Article
mouse	WB	Dev Cell Controlling tissue patterning by translational regulation of signaling transcripts through the core translation factor eIF3c Authors - Kotaro Fujii View Article

Reviews

5.0 out of 5

Add a review

3 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

Tobias (Verified Customer) (10-25-2022)	clean and good antibody for wb Applications: Western Blot
Peter (Verified Customer) (10-24-2022)	Specific band at correct MW Applications: Western Blot Primary Antibody Dilution: 1:500 Cell Tissue Type: A549
Joleen (Verified Customer) (06-10-2019)	EIF3D antibody recognizes a prominent band around the correct molecular weight. Applications: Western Blot, Primary Antibody Dilution: 1:1k Cell Tissue Type: MDCK GII EIF3D Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:10219-1-AP)