EIF3M Monoclonal antibody

EIF3M Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66025-1-Ig
Clone No.2A12B2

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

PCID1, 2A12B2, B5, EIF3, GA17

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, MCF-7 cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman colon cancer tissue, human cervical cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66025-1-Ig targets EIF3M in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17965

Product name: Recombinant human EIF3M protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-374 aa of BC019103

Sequence: MSVPAFIDISEEDQAAELRAYLKSKGAEISEENSEGGLHVDLAQIIEACDVCLKEDDKDVESVMNSVVSLLLILEPDKQEALIESLCEKLVKFREGERPSLRLQLLSNLFHGMDKNTPVRYTVYCSLIKVAASCGAIQYIPTELDQVRKWISDWNLTTEKKHTLLRLLYEALVDCKKSDAASKVMVELLGSYTEDNASQARVDAHRCIVRALKDPNAFLFDHLLTLKPVKFLEGELIHDLLTIFVSAKLASYVKFYQNNKDFIDSLGLLHEQNMAKMRLLTFMGMAVENKEISFDTMQQELQIGADDVEAFVIDAVRTKMVYCKIDQTQRKVVVSHSTHRTFGKQQWQQLYDTLNAWKQNLNKVKNSLLSLSDT

Predict reactive species
Full Name eukaryotic translation initiation factor 3, subunit M
Calculated Molecular Weight 374 aa, 43 kDa
Observed Molecular Weight 35-43 kDa
GenBank Accession NumberBC019103
Gene Symbol EIF3M
Gene ID (NCBI) 10480
RRIDAB_11042448
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7L2H7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EIF3M gene encodes eukaryotic translation initiation factor (eIF) subunit M, also called GA17 or PCID1. eIF-3 complex is required for several steps in the initiation of protein synthesis, and recent studies indicate that regulation of oncogene expression and neoplastic transformation are controlled by eIF subunits. The most uncharacterized non-core subunit EIF3M was confirmed to be highly expressed in human cancer cell lines and colon cancer patient tissues and mediate regulation of tumorigenesis-related genes in human colon cancer.

Protocols

Product Specific Protocols
WB protocol for EIF3M antibody 66025-1-IgDownload protocol
IHC protocol for EIF3M antibody 66025-1-IgDownload protocol
IF protocol for EIF3M antibody 66025-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...