Tested Applications
| Positive WB detected in | HeLa cells, A549 cells, mouse heart tissue, HepG2 cells |
| Positive IF/ICC detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 8 publications below |
| IHC | See 2 publications below |
| IF | See 2 publications below |
| IP | See 1 publications below |
Product Information
17282-1-AP targets EIF4E3 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag11056 Product name: Recombinant human EIF4E3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-118 aa of BC031289 Sequence: MRGERRPLWEEESNAKGGVWKMKVPKDSTSTVWKELLLATIGEQFTDCAAADDEVIGVSVSVRDREDVVQVWNVNASLVGEATVLEKIYELLPHITFKAVFYKPHEEHHAFEGGRGKH Predict reactive species |
| Full Name | eukaryotic translation initiation factor 4E family member 3 |
| Calculated Molecular Weight | 24 kDa |
| Observed Molecular Weight | 24-30 kDa |
| GenBank Accession Number | BC031289 |
| Gene Symbol | EIF4E3 |
| Gene ID (NCBI) | 317649 |
| RRID | AB_2262162 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N5X7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EIF4E3, also known as Eukaryotic translation initiation factor 4E type 3, is a 224 amino acid protein, which recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis. EIF4E3 acts as a tissue-specific tumor suppressor. For instance, eIF4E3 inhibits expression of both mRNA export and translation targets of eIF4E1, consistent with its nuclear and cytoplasmic localization. Importantly, eIF4E3 overexpression represses oncogenic transformation. (PMID: 23587918).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EIF4E3 antibody 17282-1-AP | Download protocol |
| WB protocol for EIF4E3 antibody 17282-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun MNKs act as a regulatory switch for eIF4E1 and eIF4E3 driven mRNA translation in DLBCL. | ||
Mol Ther RNA m6A methylation regulates the dissemination of cancer cells via modulating expression and membrane localization of β-catenin. | ||
iScience Transcriptome, proteome, and protein synthesis within the intracellular cytomatrix | ||
Oncotarget Noncanonical SQSTM1/p62-Nrf2 pathway activation mediates proteasome inhibitor resistance in multiple myeloma cells via redox, metabolic and translational reprogramming.
|
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Nadeem (Verified Customer) (12-05-2025) | ANtibody was Okay
|







