Tested Applications
Positive IHC detected in | human hepatocirrhosis tissue, human brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 8 publications below |
Product Information
21160-1-AP targets ELOVL6 in IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14163 Product name: Recombinant human ELOVL6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-80 aa of BC001305 Sequence: MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALR Predict reactive species |
Full Name | ELOVL family member 6, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast) |
Calculated Molecular Weight | 265 aa, 31 kDa |
Observed Molecular Weight | 29-32 kDa |
GenBank Accession Number | BC001305 |
Gene Symbol | ELOVL6 |
Gene ID (NCBI) | 79071 |
RRID | AB_10694572 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9H5J4 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for ELOVL6 antibody 21160-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Clin Transl Med NAT10: An RNA cytidine transferase regulates fatty acid metabolism in cancer cells | ||
Drug Des Devel Ther Selective Inhibition of 11β-Hydroxysteroid Dehydrogenase Type 1 Attenuates High-Fat Diet-Induced Hepatic Steatosis in Mice. | ||
Biochim Biophys Acta Brg1 regulates pro-lipogenic transcription by modulating SREBP activity in hepatocytes. | ||
Front Pharmacol Baicalein Prevents Fructose-Induced Hepatic Steatosis in Rats: In the Regulation of Fatty Acid De Novo Synthesis, Fatty Acid Elongation and Fatty Acid Oxidation. | ||
Animals (Basel) m6A Methylation Mediates the Function of the circRNA-08436/miR-195/ELOVL6 Axis in Regards to Lipid Metabolism in Dairy Goat Mammary Glands |