Tested Applications
Positive WB detected in | mouse brain tissue, human liver tissue, human lung tissue, human spleen tissue, mouse kidney tissue, mouse liver tissue, mouse lung tissue, mouse testis tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 24 publications below |
IHC | See 15 publications below |
IF | See 1 publications below |
Product Information
11337-1-AP targets ENT1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1881 Product name: Recombinant human ENT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 150-456 aa of BC008954 Sequence: INSFGAILQGSLFGLAGLLPASYTAPIMSGQGLAGFFASVAMICAIASGSELSESAFGYFITACAVIILTIICYLGLPRLEFYRYYQQLKLEGPGEQETKLDLISKGEEPRAGKEESGVSVSNSQPTNESHSIKAILKNISVLAFSVCFIFTITIGMFPAVTVEVKSSIAGSSTWERYFIPVSCFLTFNIFDWLGRSLTAVFMWPGKDSRWLPSLVLARLVFVPLLLLCNIKPRRYLTVVFEHDAWFIFFMAAFAFSNGYLASLCMCFGPKKVKPAEAETAGAIMAFFLCLGLALGAVFSFLFRAIV Predict reactive species |
Full Name | solute carrier family 29 (nucleoside transporters), member 1 |
Calculated Molecular Weight | 50 kDa |
Observed Molecular Weight | 62 kDa |
GenBank Accession Number | BC008954 |
Gene Symbol | ENT1 |
Gene ID (NCBI) | 2030 |
RRID | AB_2190784 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q99808 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ENT1 (equilibrative nucleoside transporter 1; also known as SLC29A1) is a ubiquitous protein located at the cell membrane and is a major transporter responsible for the cellular uptake and release of endogenous nucleosides such as adenosine, and nucleoside analogs used in chemotherapy. The predicted molecular weight of ENT1 is 50 kDa, while heavier 54-62 kDa band may be observed due to the glycosylation (16448802, 11850433, 16111480). A smaller novel splice variant of the mouse ENT1 has also been identified, which generates a protein of 35-40 kDa (18413666).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ENT1 antibody 11337-1-AP | Download protocol |
IHC protocol for ENT1 antibody 11337-1-AP | Download protocol |
IP protocol for ENT1 antibody 11337-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Targeting Pin1 renders pancreatic cancer eradicable by synergizing with immunochemotherapy.
| ||
Gastroenterology ZIP4 Increases Expression of Transcription Factor ZEB1 to Promote Integrin α3β1 Signaling and Inhibit Expression of the Gemcitabine Transporter ENT1 in Pancreatic Cancer Cells. | ||
Theranostics The failure of DAC to induce OCT2 expression and its remission by hemoglobin-based nanocarriers under hypoxia in renal cell carcinoma.
| ||
Oncogene Abrogation of glutathione peroxidase-1 drives EMT and chemoresistance in pancreatic cancer by activating ROS-mediated Akt/GSK3β/Snail signaling. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Parima (Verified Customer) (05-09-2023) | Since we received it in January, I have been trying to troubleshoot our western as there were so many non-specific bands so it was hard to tell which bands exactly are ENT1 bands. I have probed for ENT1 using this antibody in pancreatic cancer cell lines (BxPC3, MIA PaCa-2 and Panc-1) as well as in MDA-MB-231 breast cancer cell lines and the results were not good. I have been doing western for several years and this is the first antibody that I have a hard time troubleshooting to get nice clean bands and I even probed for ENT1 first. Can you please check if this specific lot has a problem? We had to wait for this product for so long because it was backordered and it's very disappointed to get the results we got.
![]() |