Tested Applications
Positive WB detected in | mouse liver tissue |
Positive IP detected in | mouse liver tissue |
Positive IHC detected in | human liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26746-1-AP targets ENTPD5 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25022 Product name: Recombinant human ENTPD5 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 335-428 aa of BC130485 Sequence: RAVDTDMIDYEKGGILKVEDFERKAREVCDNLENFTSGSPFLCMDLSYITALLKDGFGFADSTVLQLTKKVNNIETGWALGATFHLLQSLGISH Predict reactive species |
Full Name | ectonucleoside triphosphate diphosphohydrolase 5 |
Observed Molecular Weight | 47 kDa |
GenBank Accession Number | BC130485 |
Gene Symbol | ENTPD5 |
Gene ID (NCBI) | 957 |
RRID | AB_2880619 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O75356 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Ectonucleoside triphosphate diphosphohydrolases (NTPDases) are enzymes that are involved in the degradation of di- and triphosphate nucleotides, with important implications in several biological processes that underlie a number of physiological and pathological conditions, including cancer [PMID: 34272651]. ENTPD5 gene, hydrolyzes UDP to UMP and is mainly localized inside the cell, where it plays a critical role in the N-glycosylation and proper folding of proteins in the endoplasmic reticulum [PMID: 21074248]. It can also be secreted into the extracellular space and can work as a soluble enzyme upon cleavage of a signal peptide [PMID: 15698960]. NTPDase5 is often deregulated in cancer, likely as a consequence of TP53 mutations, where it promotes and favours tumour progression and metastasis [PMID: 27956623]. Furthermore, short NPTDase5 peptides were detected in normal and tumour cell lines, recalling the mt-PCPH oncoprotein, a truncated form of the enzyme originating from a single-nucleotide deletion described in Syrian hamster and lacking enzymatic activity [PMID: 27956623].
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ENTPD5 antibody 26746-1-AP | Download protocol |
IHC protocol for ENTPD5 antibody 26746-1-AP | Download protocol |
IP protocol for ENTPD5 antibody 26746-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |