Tested Applications
Positive WB detected in | PC-3 cells, U2OS cells |
Positive IHC detected in | human brain tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
10719-1-AP targets EPB41L3 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag1089 Product name: Recombinant human EPB41L3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 191-312 aa of BC008377 Sequence: MQCKVILLDGSEYTCDVEKRSRGQVLFDKVCEHLNLLEKDYFGLTYRDAENQKNWLDPAKEIKKQVRSGAWHFSFNVKFYPPDPAQLSEDITRYYLCLQLRDDIVSGRLPCSFVTLALLGS Predict reactive species |
Full Name | erythrocyte membrane protein band 4.1-like 3 |
Calculated Molecular Weight | 121 kDa |
Observed Molecular Weight | 120-130 kDa |
GenBank Accession Number | BC008377 |
Gene Symbol | EPB41L3 |
Gene ID (NCBI) | 23136 |
RRID | AB_2098488 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y2J2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
EPB41L3, also known as 4.1B and DAL1, belongs to the protein 4.1 family. It is a tumor suppressor that inhibits cell proliferation and promotes apoptosis. EPB41L3 modulates the activity of protein arginine N-methyltransferases, including PRMT3 and PRMT5 (PMID: 15334060, 15737618). DAL1 loss is an early event in meningioma tumorigenesis (PMID: 10888600).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for EPB41L3 antibody 10719-1-AP | Download protocol |
IHC protocol for EPB41L3 antibody 10719-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |