• Featured Product
  • KD/KO Validated

EphA4 Polyclonal antibody

EphA4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 21875-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA, Cell treatment

Ephrin type A receptor 4, EPH-like kinase 8, EPH receptor A4, EPH like kinase 8, EK8

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inNeuron cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21875-1-AP targets EphA4 in WB, IHC, IF/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag16233

Product name: Recombinant human EPHA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 481-603 aa of BC026327

Sequence: KDQNERSYRIVRTAARNTDIKGLNPLTSYVFHVRARTAAGYGDFSEPLEVTTNTVPSRIIGDGANSTVLLVSVSGSVVLVVILIAAFVISRRRSKYSKAKQEADEEKHLNQGVRTYVDPFTYE

Predict reactive species
Full Name EPH receptor A4
Calculated Molecular Weight 986 aa, 110 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC026327
Gene Symbol EPHA4
Gene ID (NCBI) 2043
RRIDAB_2878936
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP54764
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EphA4 is a member of the Eph receptor tyrosine kinase family and has important functions in the developing and adult nervous system (PMID: 14697664). The Eph receptors comprise a large family of closely related transmembrane tyrosine kinases that actively signal when bound to their ephrin ligands. The Eph receptors are characterized by an extracellular region with a unique cysteine-rich motif extending over its amino-terminal half, followed by two fibronectin type III motifs (PMID: 9530499). They are divided into two sub-groups (EphA and EphB) based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands (PMID: 11114742). EphA4 is involved in commissure formation within the forebrain, axonal guidance in the corticospinal tract, regulation of the central pattern generator that provides normal locomotor function and axonal regeneration following spinal cord injury (PMID: 30061574). EphA4 has been implicated as a disease modifier of amyotrophic lateral sclerosis (ALS) (PMID: 22922411).

Protocols

Product Specific Protocols
WB protocol for EphA4 antibody 21875-1-APDownload protocol
IHC protocol for EphA4 antibody 21875-1-APDownload protocol
IP protocol for EphA4 antibody 21875-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Commun

EphB4 and ephrinB2 act in opposition in the head and neck tumor microenvironment.

Authors - Shilpa Bhatia
mouseIHC

Proc Natl Acad Sci U S A

Endothelial deletion of EPH receptor A4 alters single-cell profile and Tie2/Akap12 signaling to preserve blood-brain barrier integrity

Authors - Alison Cash
humanWB,IHC

Biochem Biophys Res Commun

Single-chain fragment antibody disrupting the EphA4 function as a therapeutic drug for gastric cancer

Authors - Chen-Wei Chiang
ratWB

Brain Res Bull

Electroacupuncture ameliorates chronic unpredictable mild stress-induced depression-like behavior and cognitive impairment through suppressing oxidative stress and neuroinflammation in rats

Authors - Tao Tong
humanIF

bioRxiv

Identification of new ciliary signaling pathways in the brain and insights into neurological disorders

Authors - Abdelhalim Loukil
humanWB,IP

EMBO J

Ephrin A1 functions as a ligand of EGFR to promote EMT and metastasis in gastric cancer

Authors - Shuang Li
Loading...
||
New chat Able
正在加载,请稍候...