Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EPHA7 Monoclonal antibody

EPHA7 Monoclonal Antibody for WB, ELISA

Cat No. 66667-1-Ig
Clone No. 1A7E5
Publications (4)
Review Product
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

WB, ELISA
For FC, select conjugated version.

EC:2.7.10.1, EHK 3, EHK3, EHK-3, EK11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 647
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for EPHA7 in ?

Tested Applications

Positive WB detected inhuman brain tissue, pig brain tissue, rat brain tissue, mouse cerebellum tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66667-1-Ig targets EPHA7 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3813

Product name: Recombinant human EPHA7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 29-279 aa of BC027940

Sequence: AAKEVLLLDSKAQQTELEWISSPPNGWEEISGLDENYTPIRTYQVCQVMEPNQNNWLRTNWISKGNAQRIFVELKFTLRDCNSLPGVLGTCKETFNLYYYETDYDTGRNVRENLYVKIDTIAADESFTQGDLGERKMKLNTEVREIGPLSKKGFYLAFQDVGACIALVSVKVYYKKCWSIIENLAIFPDTVTGSEFSSLVEVRGTCVSSAEEEAENAPRMHCSAEGEWLVPIGKCICKAGYQQKGDTCECK

Predict reactive species
Full Name EPH receptor A7
Calculated Molecular Weight 998 aa, 112 kDa
Observed Molecular Weight 120 kDa
GenBank Accession NumberBC027940
Gene Symbol EPHA7
Gene ID (NCBI) 2045
RRIDAB_2882021
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15375
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ephrin receptor A7 (EphA7) is a member of the Eph receptor family. EPHA7 plays a role in corticogenesis processes, determines brain size and shape, and is involved in development of the central nervous system (PMID:34176129). In addition, EphA7 also has a dual role of tumor promoter and tumor suppressor. It can participate in cell proliferation, migration and apoptosis through various mechanisms, and afect tumor diferentiation, staging and prognosis. EphA7 may be a potential diagnostic marker and tumor treatment target (PMID:35112312).

Protocols

Product Specific Protocols
WB protocol for EPHA7 antibody 66667-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The EPHA7 Monoclonal antibody (1A7E5), catalog number 66667-1-Ig, has 4 total citations. These appear in Advanced Science, Cell Reports, International Journal of Molecular Sciences, and Experimental Neurology. The cited research spans gastric cancer liquid biopsy, myeloid leukemia, pancreatic tumorigenesis, and neuroinflammation associated with postoperative cognitive dysfunction. All citations used the antibody for Western blot (WB) applications in human and mouse samples.

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Transcriptomics-Based Liquid Biopsy for Early Detection of Recurrence in Locally Advanced Gastric Cancer

Authors - Ping'an Ding
  • KD Validated
mouseWB

Cell Rep

Activation of GPR44 decreases severity of myeloid leukemia via specific targeting of leukemia initiating stem cells

Authors - Fenghua Qian
mouseWB

Int J Mol Sci

Fucoxanthin Prevents Pancreatic Tumorigenesis in C57BL/6J Mice That Received Allogenic and Orthotopic Transplants of Cancer Cells.

Authors - Wataru Murase

Exp Neurol

Attenuation of postoperative cognitive dysfunction by Mongolian medical warm acupuncture associates with suppressed neuroinflammation and preserved synaptic structural plasticity.

Authors - Meng Meng
Loading...
||
New chat

Able™

正在加载,请稍候...