Use Able AI chat for product recommendations

ErbB3/HER3 Polyclonal antibody

ERBB3 Polyclonal Antibody for IHC, ELISA

Cat No. 10369-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, ELISA, Cell treatment

c erbB 3, c erbB3, ErbB 3, ERBB3, erbB3 S, HER3, LCCS2, MDA BF 1, p180 ErbB3, p45 sErbB3, p85 sErbB3

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inhuman breast cancer tissue, human prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10369-1-AP targets ERBB3 in WB, IHC, ELISA, Cell treatment applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0215

Product name: Recombinant human ERBB3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 88-331 aa of BC002706

Sequence: LVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKAF

Predict reactive species
Full Name v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)
Calculated Molecular Weight 148 kDa
GenBank Accession NumberBC002706
Gene Symbol ERBB3
Gene ID (NCBI) 2065
RRIDAB_2099548
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP21860
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

V-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (ErbB-3, HER3) is a member of the EGF receptor tyrosine kinase family including EGFR (HER1), Neu (ErbB-2, HER2), ErbB-3 (HER3), and ErbB-4 (HER4) that are frequently overexpressed in a variety of carcinomas. These family members form either homodimers or heterodimers upon ligand binding to mediate cell growth. ErbB-3 binds and is activated by neuregulins and NTAK. It forms a heterodimer with each of the other ErbB receptors. ErbB-3 is predominantly expressed in epithelial tissues and brain, and is overexpressed in a subset of human mammary tumors.

Protocols

Product Specific Protocols
IHC protocol for ERBB3 antibody 10369-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Acta Pharmacol Sin

Quantitative systems pharmacology modeling of HER2-positive metastatic breast cancer for translational efficacy evaluation and combination assessment across therapeutic modalities

Authors - Ya-Ting Zhou
humanWB

Oncotarget

Tumor suppressor role of miR-3622b-5p in ERBB2-positive cancer.

Authors - Mingjie Lu
humanWB

Cells

NOX4 Signaling Mediates Cancer Development and Therapeutic Resistance through HER3 in Ovarian Cancer Cells.

Authors - Wen-Jing Liu
humanWB

J Oncol

CircEPSTI1 Promotes the Proliferation of HER2-Positive Breast Cancer Cells via circEPSTI1/miR-145/ERBB3 Axis

Authors - Yue Zhang
humanIHC

Acta Otolaryngol

ErbB1 and ErbB2 overexpression in patients with sinonasal inverted papilloma and inverted papilloma with squamous cell carcinoma in China.

Authors - Hongbing Li
humanIHC

Can Respir J

Cytokine Expression Profiling in Idiopathic Pulmonary Fibrosis: Insights From Integrative Proteomic Analysis.

Authors - Chenyou Shen

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Morgan (Verified Customer) (10-26-2021)

I could not get any detection for this antibody at all. It strangely appeared on the ladder and I did not know how to troubleshoot. It occurred in both western blot attempts that I tried (Please see images)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: OV90 Ovarian Cancer Cells
ERBB3 Antibody Western Blot validation (1:500 dilution) in OV90 Ovarian Cancer Cells (Cat no:10369-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...