ERK1/2 Polyclonal antibody

ERK1/2 Polyclonal Antibody for WB, IF, IHC, ELISA

Cat No. 16443-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IP, ELISA

ERK, ERK 2, ERK1/2, ERK2, ERT1, MAP kinase 1, MAP kinase 2, MAP kinase isoform p42, MAPK 1, MAPK 2, MAPK1, MAPK2, p40, p41, p41mapk, p42 MAPK, P42MAPK, PRKM1, PRKM2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells, A431 cells, mouse kidney tissue, HEK-293 cells, HeLa cells, PC-3 cells, rat kidney tissue, mouse brain tissue, rat brain tissue
Positive IHC detected inhuman liver tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16443-1-AP targets ERK1/2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, chicken, sheep, eriocheir sinensis
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9772

Product name: Recombinant human ERK1/2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-360 aa of BC017832

Sequence: YTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Predict reactive species
Full Name mitogen-activated protein kinase 1
Calculated Molecular Weight 360 aa, 41 kDa
Observed Molecular Weight 38-44 kDa
GenBank Accession NumberBC017832
Gene Symbol ERK2
Gene ID (NCBI) 5594
RRIDAB_10603369
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP28482
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ERK1 and ERK2 belongs to the protein kinase superfamily. It is involved in both the initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors such as ELK-1. ERK1/2 catalized the reaction: ATP + a protein = ADP + a phosphoprotein. It is activated by tyrosine phosphorylation in response to INS and NGF. This antibody can recognize both ERK1 and ERK2 with the molecular mass of 38-44 kDa.

Publications

SpeciesApplicationTitle
humanWB

Dev Cell

Lactylation of LSD1 is an acquired epigenetic vulnerability of BRAFi/MEKi-resistant melanoma

Authors - Aicun Li
humanWB

J Immunother Cancer

TSH-TSHR axis promotes tumor immune evasion.

Authors - Zhenghao Wu
humanWB

Cancer Lett

Direct contact between tumor cells and platelets initiates a FAK-dependent F3/TGF-β positive feedback loop that promotes tumor progression and EMT in osteosarcoma

Authors - Qianyu Shi
ratWB

Adv Sci (Weinh)

An Important Function of Petrosiol E in Inducing the Differentiation of Neuronal Progenitors and in Protecting Them against Oxidative Stress.

Authors - Jing Liu
humanWB

J Hazard Mater

ZnO NPs delay the recovery of psoriasis-like skin lesions through promoting nuclear translocation of p-NFκB p65 and cysteine deficiency in keratinocytes.

Authors - Xuan Lai
humanWB,IP

Cell Death Dis

4EBP1 senses extracellular glucose deprivation and initiates cell death signaling in lung cancer

Authors - Yanan Wang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Macarena Lucia (Verified Customer) (10-17-2022)

good results on human lysates

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Tom (Verified Customer) (09-29-2020)

10ug of HEK293T total cell lysate in SDS loading buffer was loaded and ran on a 4-20% gradient gel. Blocking was performed in 5% BSA in TBS for 1 hour then membrane incubated at 4 degrees overnight with anti-ERK 1/2 antibody (1:1000) in block. A goat anti-rabbit HRP secondary antibody (1:10,000) was used.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293T
ERK1/2 Antibody Western Blot validation (1:1000 dilution) in HEK293T (Cat no:16443-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...