Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

EXOSC2 Polyclonal antibody

EXOSC2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 14805-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, IP, ELISA

Exosome complex component RRP4, Exosome component 2, hRrp4p, Ribosomal RNA-processing protein 4, RRP4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, HEK-293 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14805-1-AP targets EXOSC2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, yeast
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6525

Product name: Recombinant human EXOSC2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-293 aa of BC000747

Sequence: MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Predict reactive species
Full Name exosome component 2
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 30-33 kDa
GenBank Accession NumberBC000747
Gene Symbol EXOSC2
Gene ID (NCBI) 23404
RRIDAB_2101837
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13868
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snoRNA and snRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs [PMID:15346807]. EXOSC2 is a non-catalytic component of the RNA exosome complex that has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events [PMID: 17545563].

Protocols

Product Specific Protocols
IF protocol for EXOSC2 antibody 14805-1-APDownload protocol
IHC protocol for EXOSC2 antibody 14805-1-APDownload protocol
IP protocol for EXOSC2 antibody 14805-1-APDownload protocol
WB protocol for EXOSC2 antibody 14805-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB,IF

Cell

Modulated Expression of Specific tRNAs Drives Gene Expression and Cancer Progression.

Authors - Hani Goodarzi
human

Cell

The Human RNA-Binding Proteome and Its Dynamics during Translational Arrest.

Authors - Jakob Trendel
yeastWB

G3 (Bethesda)

Humanized Saccharomyces cerevisiae provides a facile and effective tool to identify damaging human variants that cause exosomopathies

Authors - Khondakar Sayef Ahammed
mouse,humanWB

Mol Cell

The MYCN oncoprotein is an RNA-binding accessory factor of the nuclear exosome targeting complex

Authors - Dimitrios Papadopoulos

EMBO J

Cellular assembly and functional resilience of the mammalian RNA exosome.

Authors - Tsimafei Navalayeu
humanWB

Mol Biotechnol

EXOSC2 Mediates the Pro-tumor Role of WTAP in Breast Cancer Cells via Activating the Wnt/β-Catenin Signal

Authors - Chen-Guang Lv
  • KD Validated

Reviews

    5.0 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Moritz (Verified Customer) (01-15-2026)

Antibody works well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T
EXOSC2 Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:14805-1-AP)

Aleksandr (Verified Customer) (07-29-2025)

Excellent antibody for human Exosc2 detection

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: RKO
EXOSC2 Antibody Western Blot validation (1:5000 dilution) in RKO (Cat no:14805-1-AP)

Tsimafei (Verified Customer) (12-04-2022)

50µg of total protein were loaded on a gel. Incubation ON at 4C

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: mESCs
EXOSC2 Antibody Western Blot validation (1:5000 dilution) in mESCs (Cat no:14805-1-AP)

Nikolaus (Verified Customer) (07-14-2022)

Antibodies were incubated ON at 4C.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mESCs
EXOSC2 Antibody Western Blot validation (1:1000 dilution) in mESCs (Cat no:14805-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...