Tested Applications
| Positive WB detected in | HepG2 cells, HeLa cells, HEK-293 cells, U2OS cells, LNCaP cells, Jurkat cells, K-562 cells |
| Positive IHC detected in | human liver tissue, human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:10-1:100 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 7 publications below |
Product Information
66099-1-Ig targets EXOSC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Mouse / IgG2a |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7003 Product name: Recombinant human EXOSC2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-293 aa of BC000747 Sequence: MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG Predict reactive species |
| Full Name | exosome component 2 |
| Calculated Molecular Weight | 33 kDa |
| Observed Molecular Weight | 33 kDa |
| GenBank Accession Number | BC000747 |
| Gene Symbol | EXOSC2 |
| Gene ID (NCBI) | 23404 |
| RRID | AB_2881498 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q13868 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snoRNA and snRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs [PMID:15346807]. EXOSC2 is a non-catalytic component of the RNA exosome complex that has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events [PMID: 17545563].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for EXOSC2 antibody 66099-1-Ig | Download protocol |
| IHC protocol for EXOSC2 antibody 66099-1-Ig | Download protocol |
| WB protocol for EXOSC2 antibody 66099-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Front Endocrinol (Lausanne) FGF2 Is Protective Towards Cisplatin-Induced KGN Cell Toxicity by Promoting FTO Expression and Autophagy. | ||
Reprod Biol Endocrinol FTO protects human granulosa cells from chemotherapy-induced cytotoxicity. | ||
bioRxiv Low expression of EXOSC2 protects against clinical COVID-19 and impedes SARS-CoV-2 replication. | ||
Life Sci Alliance Low expression of EXOSC2 protects against clinical COVID-19 and impedes SARS-CoV-2 replication | ||
J Assist Reprod Genet The melatonin-FTO-ATF4 signaling pathway protects granulosa cells from cisplatin-induced chemotherapeutic toxicity by suppressing ferroptosis |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Moritz (Verified Customer) (01-15-2026) | Great and specific antibody
![]() |
FH Nikolaus (Verified Customer) (07-14-2022) | Exosc2 depletion is used as a control. Antibodies were incubated ON at 4C.
![]() |
FH Tsimafei (Verified Customer) (06-01-2022) | WT and Exosc2 depletion were compared. There is a clear reduction of Exosc2 signal upon the depletion. Though, the strength of the signla isn't great. Antibodies were incubated at 4C, ON.
![]() |


















