Use Able AI chat for product recommendations

EXOSC2 Monoclonal antibody

EXOSC2 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66099-1-Ig
Clone No.1G8B1

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

1G8B1, Exosome complex component RRP4, Exosome component 2, hRrp4p, Ribosomal RNA-processing protein 4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite®555
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, HEK-293 cells, U2OS cells, LNCaP cells, Jurkat cells, K-562 cells
Positive IHC detected inhuman liver tissue, human skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:10-1:100
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66099-1-Ig targets EXOSC2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag7003

Product name: Recombinant human EXOSC2 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-293 aa of BC000747

Sequence: MAMEMRLPVARKPLSERLGRDTKKHLVVPGDTITTDTGFMRGHGTYMGEEKLIASVAGSVERVNKLICVKALKTRYIGEVGDIVVGRITEVQQKRWKVETNSRLDSVLLLSSMNLPGGELRRRSAEDELAMRGFLQEGDLISAEVQAVFSDGAVSLHTRSLKYGKLGQGVLVQVSPSLVKRQKTHFHDLPCGASVILGNNGFIWIYPTPEHKEEEAGGFIANLEPVSLADREVISRLRNCIISLVTQRMMLYDTSILYCYEASLPHQIKDILKPEIMEEIVMETRQRLLEQEG

Predict reactive species
Full Name exosome component 2
Calculated Molecular Weight 33 kDa
Observed Molecular Weight 33 kDa
GenBank Accession NumberBC000747
Gene Symbol EXOSC2
Gene ID (NCBI) 23404
RRIDAB_2881498
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ13868
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

In the nucleus, the RNA exosome complex is involved in proper maturation of stable RNA species such as rRNA, snoRNA and snRNA, in the elimination of RNA processing by-products and non-coding 'pervasive' transcripts, such as antisense RNA species and promoter-upstream transcripts (PROMPTs), and of mRNAs with processing defects, thereby limiting or excluding their export to the cytoplasm. In the cytoplasm, the RNA exosome complex is involved in general mRNA turnover and specifically degrades inherently unstable mRNAs containing AU-rich elements (AREs) within their 3' untranslated regions, and in RNA surveillance pathways, preventing translation of aberrant mRNAs [PMID:15346807]. EXOSC2 is a non-catalytic component of the RNA exosome complex that has 3'->5' exoribonuclease activity and involves in a multitude of cellular RNA processing and degradation events [PMID: 17545563].

Protocols

Product Specific Protocols
IF protocol for EXOSC2 antibody 66099-1-IgDownload protocol
IHC protocol for EXOSC2 antibody 66099-1-IgDownload protocol
WB protocol for EXOSC2 antibody 66099-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
human

Cell

The Human RNA-Binding Proteome and Its Dynamics during Translational Arrest.

Authors - Jakob Trendel
humanWB

Front Endocrinol (Lausanne)

FGF2 Is Protective Towards Cisplatin-Induced KGN Cell Toxicity by Promoting FTO Expression and Autophagy.

Authors - Rongli Wang
humanWB

Reprod Biol Endocrinol

FTO protects human granulosa cells from chemotherapy-induced cytotoxicity.

Authors - Rongli Wang
humanWB

bioRxiv

Low expression of EXOSC2 protects against clinical COVID-19 and impedes SARS-CoV-2 replication.

Authors - Tobias Moll

J Ovarian Res

FTO attenuates the cytotoxicity of cisplatin in KGN granulosa cell-like tumour cells by regulating the Hippo/YAP1 signalling pathway

Authors - Rongli Wang
humanWB

Sci Rep

Resveratrol delays senescence of human dental pulp stem cells via activating the SIRT1-mitochondrial autophagy.

Authors - Zelu Li

Reviews

    4.2 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Aleksandr (Verified Customer) (02-07-2026)

Antibody works great!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: RKO
EXOSC2 Antibody Western Blot validation (1:3000 dilution) in RKO (Cat no:66099-1-Ig)

Moritz (Verified Customer) (01-15-2026)

Great and specific antibody

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HEK293T
EXOSC2 Antibody Western Blot validation (1:3000 dilution) in HEK293T (Cat no:66099-1-Ig)

Nikolaus (Verified Customer) (07-14-2022)

Exosc2 depletion is used as a control. Antibodies were incubated ON at 4C.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mESCs
EXOSC2 Antibody Western Blot validation (1:1000 dilution) in mESCs (Cat no:66099-1-Ig)

Tsimafei (Verified Customer) (06-01-2022)

WT and Exosc2 depletion were compared. There is a clear reduction of Exosc2 signal upon the depletion. Though, the strength of the signla isn't great. Antibodies were incubated at 4C, ON.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mESCs
EXOSC2 Antibody Western Blot validation (1:1000 dilution) in mESCs (Cat no:66099-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...