Use Able AI chat for product recommendations

Factor XII Monoclonal antibody

Factor XII Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 66089-1-Ig
Clone No.2E2F11

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

F12, Factor 12, EC:3.4.21.38, Coagulation factor XII, Beta-factor XIIa part 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK562 cells, K-562 cells
Positive IHC detected inhuman liver tissue, human kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66089-1-Ig targets Factor XII in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag3401

Product name: Recombinant human F12 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 316-615 aa of BC012390

Sequence: MPAQPAPPKPQPTTRTPPQSQTPGALPAKREQPPSLTRNGPLSCGQRLRKSLSSMTRVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREHTVS

Predict reactive species
Full Name coagulation factor XII (Hageman factor)
Calculated Molecular Weight 615 aa, 68 kDa
Observed Molecular Weight 28 kDa
GenBank Accession NumberBC012390
Gene Symbol Factor XII
Gene ID (NCBI) 2161
RRIDAB_11232031
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00748
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Factor XII (F XII, Hageman factor) is a 80 kDa, single chain glycoprotein that circulates in blood as an inactive zymogen. F XII plays an important role in blood coagulation, fibrinolysis, and kinin generation. Factor XII is activated by kallikrein in alpha-factor XIIa, which is further converted by trypsin into beta-factor XIIa. Alpha-factor XIIa is composed of a 52 kDa NH2-terminal heavy chain, called coagulation factor XIIa heavy chain, and a 28 kDa COOH-terminal light chain, called coagulation factor XIIa light chain, connected by a disulfide bond. Beta-factor XIIa is composed of 2 chains linked by a disulfide bond, an N-terminal nonapeptide, called beta-factor XIIa part 1, and coagulation factor XIIa light chain, also known in this context as beta-factor XIIa part 2.

Protocols

Product Specific Protocols
IF protocol for Factor XII antibody 66089-1-IgDownload protocol
IHC protocol for Factor XII antibody 66089-1-IgDownload protocol
WB protocol for Factor XII antibody 66089-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

J Clin Endocrinol Metab

High-Throughput Proteomics and Immunohistochemistry of Orbital Connective Tissue in Graves' Orbitopathy

Authors - Yuanping Hai
humanWB

Int J Mol Sci

Coagulation Factor XII Is an Antibacterial Protein That Acts Against Bacterial Infection via Its Heavy Chain

Authors - Junnan Liu
humanIF

Res Pract Thromb Haemost

Factor XI localization in human deep venous thrombus and function of activated factor XI on venous thrombus formation and hemostasis.

Authors - Nobuyuki Oguri
mouseWB

Mol Ther Nucleic Acids

Antithrombotic Effect of shRNA Target F12 Mediated by Adeno-Associated Virus.

Authors - Fanfan Li
Loading...
||
New chat

Able

正在加载,请稍候...