Tested Applications
| Positive WB detected in | COLO 320 cells, DU 145 cells, LNCaP cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 9 publications below |
| IHC | See 1 publications below |
| IF | See 1 publications below |
Product Information
12160-1-AP targets PAR2 in WB, IHC, IF, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2801 Product name: Recombinant human F2RL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 15-87 aa of BC018130 Sequence: LLAASLSCSGTIQGTNRSSKGRSLIGKVDGTSHVTGKGVTVETVFSVDEFSASVLTGKLTTVFLPIVYTIVFV Predict reactive species |
| Full Name | coagulation factor II (thrombin) receptor-like 1 |
| Calculated Molecular Weight | 397 aa, 44 kDa |
| Observed Molecular Weight | 50-55 kDa |
| GenBank Accession Number | BC018130 |
| Gene Symbol | PAR2 |
| Gene ID (NCBI) | 2150 |
| RRID | AB_10598009 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55085 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Proteinase-activated receptors (PARs) are G protein-coupled receptors activated through cleavage of their N-termini by mainly serine proteases. The family of PARs includes four members: PAR1, PAR2, PAR3, and PAR4. PAR2, also known as F2RL1, is expressed in epithelial cells (e.g., lung, gastrointestinal tract), endothelial cells, smooth muscle cells, fibroblasts, nerves, and some immune and inflammatory cells. PAR2 knockout mice and PAR2 agonists and antagonists have implicated PAR2 as a promising target in inflammatory conditions; respiratory, gastrointestinal, metabolic, cardiovascular, and neurological dysfunction; and cancers. (PMID:23895492)
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PAR2 antibody 12160-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Cells Modulation of Intestinal Epithelial Permeability via Protease-Activated Receptor-2-Induced Autophagy. | ||
Oral Dis Linagliptin's impact on lymphatic barrier and lymphangiogenesis in oral cancer with high glucose | ||
Biochem J Protease-Activated Receptor-2 promotes kidney tubular epithelial inflammation by inhibiting autophagy via the PI3K/Akt/mTOR signalling pathway. | ||
Med Oncol Long non-coding RNA AC245100.4 contributes to prostate cancer migration via regulating PAR2 and activating p38-MAPK pathway.
| ||
Heliyon Long non-coding RNA AC245100.4 activates the PI3K/AKT pathway to promote PCa cell proliferation by elevating PAR2 |

