Tested Applications
| Positive WB detected in | mouse lung tissue, mouse pancreas tissue |
| Positive IHC detected in | mouse lung tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
Product Information
25306-1-AP targets F2RL3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20801 Product name: Recombinant human F2RL3 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 305-385 aa of BC074782 Sequence: LHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSPGDTVASKASAEGGSRGMGTHSSLLQ Predict reactive species |
| Full Name | coagulation factor II (thrombin) receptor-like 3 |
| Calculated Molecular Weight | 385 aa, 41 kDa |
| Observed Molecular Weight | 45 kDa |
| GenBank Accession Number | BC074782 |
| Gene Symbol | F2RL3 |
| Gene ID (NCBI) | 9002 |
| RRID | AB_2880022 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q96RI0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Coagulation factor II receptor-like 3 (F2RL3) encodes a member of the protease-activated receptor subfamily, also known as protease-activated receptor 4 (PAR4), which takes partin platelet activation, intimal hyperplasia and inflammation (PMID:34284820). An absence of PAR4 in mouse models results in impaired hemostasis and a protection against pulmonary embolism, and a small number of missense coding variants in F2RL3 that alter platelet aggregation and function have been described(PMID:35012325). The calculated molecular weight and observed molecular weight of F2RL3 are both 41 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for F2RL3 antibody 25306-1-AP | Download protocol |
| WB protocol for F2RL3 antibody 25306-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Oxid Med Cell Longev Combination of Colchicine and Ticagrelor Inhibits Carrageenan-Induced Thrombi in Mice. | ||
Neurosci Bull Antagonism of Protease-Activated Receptor 4 Protects Against Traumatic Brain Injury by Suppressing Neuroinflammation via Inhibition of Tab2/NF-κB Signaling. | ||
Cells The Tumor Suppressor Par-4 Regulates Adipogenesis by Transcriptional Repression of PPARγ |







